SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS30023
         (770 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At5g56450.1 68418.m07046 mitochondrial substrate carrier family ...    85   5e-17
At4g28390.1 68417.m04063 ADP, ATP carrier protein, mitochondrial...    71   9e-13
At5g13490.1 68418.m01556 ADP, ATP carrier protein 2, mitochondri...    69   3e-12
At5g17400.1 68418.m02041 ADP, ATP carrier protein, mitochondrial...    69   3e-12
At3g08580.2 68416.m00996 ADP, ATP carrier protein 1, mitochondri...    69   5e-12
At3g08580.1 68416.m00995 ADP, ATP carrier protein 1, mitochondri...    69   5e-12
At5g58970.1 68418.m07387 uncoupling protein (UCP2) identical to ...    48   5e-06
At4g03115.1 68417.m00424 mitochondrial substrate carrier family ...    42   3e-04
At5g66380.1 68418.m08370 mitochondrial substrate carrier family ...    41   8e-04
At5g01340.1 68418.m00047 mitochondrial substrate carrier family ...    41   0.001
At2g33820.1 68415.m04149 mitochondrial substrate carrier family ...    41   0.001
At1g34065.1 68414.m04223 mitochondrial substrate carrier family ...    40   0.001
At1g25380.1 68414.m03150 mitochondrial substrate carrier family ...    40   0.002
At4g32400.1 68417.m04613 mitochondrial substrate carrier family ...    39   0.003
At3g54110.1 68416.m05982 plant uncoupling mitochondrial protein ...    39   0.003
At3g53940.1 68416.m05959 mitochondrial substrate carrier family ...    39   0.004
At2g37890.1 68415.m04651 mitochondrial substrate carrier family ...    36   0.022
At5g58970.2 68418.m07388 uncoupling protein (UCP2) identical to ...    35   0.052
At5g01500.1 68418.m00064 mitochondrial substrate carrier family ...    35   0.068
At4g01100.1 68417.m00148 mitochondrial substrate carrier family ...    34   0.090
At1g14560.1 68414.m01731 mitochondrial substrate carrier family ...    34   0.090
At2g22500.1 68415.m02669 mitochondrial substrate carrier family ...    33   0.21 
At1g14140.1 68414.m01671 mitochondrial substrate carrier family ...    33   0.21 
At3g51870.1 68416.m05688 mitochondrial substrate carrier family ...    33   0.28 
At5g07320.1 68418.m00836 mitochondrial substrate carrier family ...    31   0.64 
At4g26180.1 68417.m03768 mitochondrial substrate carrier family ...    31   0.84 
At1g78180.1 68414.m09110 mitochondrial substrate carrier family ...    30   1.9  
At5g46800.1 68418.m05766 mitochondrial carnitine/acyl carrier, p...    29   3.4  
At1g74240.1 68414.m08598 mitochondrial substrate carrier family ...    29   3.4  
At3g06370.1 68416.m00735 sodium proton exchanger, putative (NHX3...    28   5.9  
At3g05420.2 68416.m00594 acyl-CoA binding family protein similar...    28   5.9  
At3g05420.1 68416.m00593 acyl-CoA binding family protein similar...    28   5.9  
At5g27150.1 68418.m03240 sodium proton exchanger / Na+/H+ antipo...    28   7.9  

>At5g56450.1 68418.m07046 mitochondrial substrate carrier family
           protein contains Pfam profile: PF00153 mitochondrial
           carrier protein
          Length = 330

 Score = 85.0 bits (201), Expect = 5e-17
 Identities = 37/73 (50%), Positives = 52/73 (71%)
 Frame = +1

Query: 1   IISYPFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLRGTGGA 180
           + SYP DTVRRR+MMQSG      +Y++T+ CW  I ++EG + F++GA SN+ R TG A
Sbjct: 255 LASYPLDTVRRRIMMQSGMEHP--MYRSTLDCWKKIYRSEGLASFYRGALSNMFRSTGSA 312

Query: 181 FVLVLYDEIKKVL 219
            +LV YDE+K+ L
Sbjct: 313 AILVFYDEVKRFL 325


>At4g28390.1 68417.m04063 ADP, ATP carrier protein, mitochondrial,
           putative / ADP/ATP translocase, putative / adenine
           nucleotide translocator, putative similar to
           mitochondrial ADP,ATP carrier protein SP:P12857 from
           [Zea mays]
          Length = 379

 Score = 70.9 bits (166), Expect = 9e-13
 Identities = 34/73 (46%), Positives = 48/73 (65%)
 Frame = +1

Query: 1   IISYPFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLRGTGGA 180
           + SYP DTVRRRMMM SG A   + YK+++  ++ I K EG    FKGA +N+LR   GA
Sbjct: 300 LASYPIDTVRRRMMMTSGEA---VKYKSSLQAFSQIVKNEGAKSLFKGAGANILRAVAGA 356

Query: 181 FVLVLYDEIKKVL 219
            VL  YD+++ ++
Sbjct: 357 GVLAGYDKLQLIV 369


>At5g13490.1 68418.m01556 ADP, ATP carrier protein 2, mitochondrial
           / ADP/ATP translocase 2 / adenine nucleotide
           translocator 2 (ANT2) identical to SWISS-PROT:P40941
           ADP,ATP carrier protein 2, mitochondrial precursor
           (Adenine nucleotide translocator 2) [Arabidopsis
           thaliana]
          Length = 385

 Score = 69.3 bits (162), Expect = 3e-12
 Identities = 34/73 (46%), Positives = 47/73 (64%)
 Frame = +1

Query: 1   IISYPFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLRGTGGA 180
           + SYP DTVRRRMMM SG A   + YK++   ++ I K EG    FKGA +N+LR   GA
Sbjct: 306 LASYPIDTVRRRMMMTSGEA---VKYKSSFDAFSQIVKKEGAKSLFKGAGANILRAVAGA 362

Query: 181 FVLVLYDEIKKVL 219
            VL  YD+++ ++
Sbjct: 363 GVLAGYDKLQLIV 375


>At5g17400.1 68418.m02041 ADP, ATP carrier protein, mitochondrial,
           putative / ADP/ATP translocase, putative / adenine
           nucleotide translocator, putative similar to
           SWISS-PROT:Q09188 ADP,ATP carrier protein (ADP/ATP
           translocase) [Schizosaccharomyces pombe]; contains Pfam
           profile: PF00153 mitochondrial carrier protein
          Length = 306

 Score = 68.9 bits (161), Expect = 3e-12
 Identities = 32/72 (44%), Positives = 48/72 (66%)
 Frame = +1

Query: 1   IISYPFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLRGTGGA 180
           +I+YPFDT+RRRMM+ SG+    + Y+NTIH    I K+EG    ++G  +N+L G  GA
Sbjct: 231 VIAYPFDTLRRRMMLTSGQP---VKYRNTIHALREILKSEGFYALYRGVTANMLLGVAGA 287

Query: 181 FVLVLYDEIKKV 216
            VL  YD++ ++
Sbjct: 288 GVLAGYDQLHQI 299


>At3g08580.2 68416.m00996 ADP, ATP carrier protein 1, mitochondrial
           / ADP/ATP translocase 1 / adenine nucleotide
           translocator 1 (ANT1) identical to SWISS-PROT:P31167
           ADP,ATP carrier protein 1 (Adenine nucleotide
           translocator 1) [Arabidopsis thaliana]
          Length = 381

 Score = 68.5 bits (160), Expect = 5e-12
 Identities = 34/73 (46%), Positives = 47/73 (64%)
 Frame = +1

Query: 1   IISYPFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLRGTGGA 180
           + SYP DTVRRRMMM SG A   + YK+++  +  I K EG    FKGA +N+LR   GA
Sbjct: 302 LASYPIDTVRRRMMMTSGEA---VKYKSSLDAFKQILKNEGAKSLFKGAGANILRAVAGA 358

Query: 181 FVLVLYDEIKKVL 219
            VL  YD+++ ++
Sbjct: 359 GVLSGYDKLQLIV 371


>At3g08580.1 68416.m00995 ADP, ATP carrier protein 1, mitochondrial
           / ADP/ATP translocase 1 / adenine nucleotide
           translocator 1 (ANT1) identical to SWISS-PROT:P31167
           ADP,ATP carrier protein 1 (Adenine nucleotide
           translocator 1) [Arabidopsis thaliana]
          Length = 381

 Score = 68.5 bits (160), Expect = 5e-12
 Identities = 34/73 (46%), Positives = 47/73 (64%)
 Frame = +1

Query: 1   IISYPFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLRGTGGA 180
           + SYP DTVRRRMMM SG A   + YK+++  +  I K EG    FKGA +N+LR   GA
Sbjct: 302 LASYPIDTVRRRMMMTSGEA---VKYKSSLDAFKQILKNEGAKSLFKGAGANILRAVAGA 358

Query: 181 FVLVLYDEIKKVL 219
            VL  YD+++ ++
Sbjct: 359 GVLSGYDKLQLIV 371


>At5g58970.1 68418.m07387 uncoupling protein (UCP2) identical to
           uncoupling protein GI:4063007 from [Arabidopsis
           thaliana]
          Length = 305

 Score = 48.4 bits (110), Expect = 5e-06
 Identities = 27/72 (37%), Positives = 37/72 (51%), Gaps = 1/72 (1%)
 Frame = +1

Query: 4   ISYPFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLR-GTGGA 180
           I  P D V+ RMM        D  Y+NT+ C+    KTEG   F+KG   N  R GT  A
Sbjct: 233 IGSPIDVVKSRMM-------GDSTYRNTVDCFIKTMKTEGIMAFYKGFLPNFTRLGTWNA 285

Query: 181 FVLVLYDEIKKV 216
            + +  +++KKV
Sbjct: 286 IMFLTLEQVKKV 297



 Score = 35.1 bits (77), Expect = 0.052
 Identities = 23/78 (29%), Positives = 41/78 (52%), Gaps = 5/78 (6%)
 Frame = +1

Query: 1   IISYPFDTVRRRMMMQ----SGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLRG 168
           + + P DT + R+ +Q    +G  ++   Y+ +I   ATIA+ EG S  +KG  + + R 
Sbjct: 28  LCTIPLDTAKVRLQLQRKIPTGDGENLPKYRGSIGTLATIAREEGISGLWKGVIAGLHRQ 87

Query: 169 -TGGAFVLVLYDEIKKVL 219
              G   + LY+ +K +L
Sbjct: 88  CIYGGLRIGLYEPVKTLL 105


>At4g03115.1 68417.m00424 mitochondrial substrate carrier family
           protein contains Pfam profile: PF00153 mitochondrial
           carrier protein
          Length = 341

 Score = 42.3 bits (95), Expect = 3e-04
 Identities = 20/73 (27%), Positives = 39/73 (53%), Gaps = 1/73 (1%)
 Frame = +1

Query: 1   IISYPFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLR-GTGG 177
           +I+ P D ++ R+M+Q G ++S   Y+N  HC   + + EG    +KG F+   R G   
Sbjct: 264 LITAPMDMIKTRLMLQQG-SESTKTYRNGFHCGYKVVRKEGPLALYKGGFAIFARLGPQT 322

Query: 178 AFVLVLYDEIKKV 216
               +L ++++ +
Sbjct: 323 MITFILCEKLRSL 335


>At5g66380.1 68418.m08370 mitochondrial substrate carrier family
           protein contains Pfam profile: PF00153 mitochondrial
           carrier protein
          Length = 308

 Score = 41.1 bits (92), Expect = 8e-04
 Identities = 21/54 (38%), Positives = 26/54 (48%)
 Frame = +1

Query: 10  YPFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLRGT 171
           +  D VR R  +  GR  S   YKNT H   TIA+ EG    + G F  V+  T
Sbjct: 25  HSLDVVRTRFQVNDGRGSSLPTYKNTAHAVFTIARLEGLRGLYAGFFPAVIGST 78



 Score = 33.9 bits (74), Expect = 0.12
 Identities = 17/69 (24%), Positives = 34/69 (49%)
 Frame = +1

Query: 13  PFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLRGTGGAFVLV 192
           P   V+ R+ +Q+   ++   Y   +  + TI K EG    +KG    ++  + GA    
Sbjct: 126 PIWLVKTRLQLQTPLHQTQP-YSGLLDAFRTIVKEEGPRALYKGIVPGLVLVSHGAIQFT 184

Query: 193 LYDEIKKVL 219
            Y+E++K++
Sbjct: 185 AYEELRKII 193


>At5g01340.1 68418.m00047 mitochondrial substrate carrier family
           protein contains Pfam profile: PF00153 mitochondrial
           carrier protein
          Length = 309

 Score = 40.7 bits (91), Expect = 0.001
 Identities = 21/66 (31%), Positives = 34/66 (51%), Gaps = 1/66 (1%)
 Frame = +1

Query: 13  PFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLR-GTGGAFVL 189
           PFD V+ R+M QS  ++  I YK  +H   TI   EG    ++G    ++R   G A + 
Sbjct: 230 PFDVVKTRLMAQSRDSEGGIRYKGMVHAIRTIYAEEGLVALWRGLLPRLMRIPPGQAIMW 289

Query: 190 VLYDEI 207
            + D++
Sbjct: 290 AVADQV 295



 Score = 39.1 bits (87), Expect = 0.003
 Identities = 21/57 (36%), Positives = 28/57 (49%), Gaps = 1/57 (1%)
 Frame = +1

Query: 13  PFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLR-GTGGA 180
           PF+ V+ R+  Q G +     YK  IHC  TI + E     + GA   V+R GT  A
Sbjct: 128 PFEVVKIRLQQQKGLSPELFKYKGPIHCARTIVREESILGLWSGAAPTVMRNGTNQA 184



 Score = 28.7 bits (61), Expect = 4.5
 Identities = 13/44 (29%), Positives = 21/44 (47%)
 Frame = +1

Query: 13  PFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKG 144
           P D ++ R+ +    A     YK   HC + + +TEG    +KG
Sbjct: 33  PIDVIKTRLQLDRVGA-----YKGIAHCGSKVVRTEGVRALWKG 71


>At2g33820.1 68415.m04149 mitochondrial substrate carrier family
           protein (BAC1) contains Pfam profile: PF00153
           mitochondrial carrier protein
          Length = 311

 Score = 40.7 bits (91), Expect = 0.001
 Identities = 17/53 (32%), Positives = 32/53 (60%)
 Frame = +1

Query: 4   ISYPFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVL 162
           + +PFDTV+ ++   +   +  + YKN +HC + I +TEG    ++GA S+ +
Sbjct: 31  VGHPFDTVKVKLQKHNTDVQG-LRYKNGLHCASRILQTEGVKGLYRGATSSFM 82


>At1g34065.1 68414.m04223 mitochondrial substrate carrier family
           protein contains Pfam profile: PF00153 mitochondrial
           carrier protein
          Length = 327

 Score = 40.3 bits (90), Expect = 0.001
 Identities = 23/74 (31%), Positives = 39/74 (52%), Gaps = 1/74 (1%)
 Frame = +1

Query: 1   IISYPFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVL-RGTGG 177
           +++ P D ++ R+M+Q     S   YK    C  TI + EG+S  +KG    VL  G GG
Sbjct: 248 VLTTPLDVIKTRLMVQG----SGTQYKGVSDCIKTIIREEGSSALWKGMGPRVLWIGIGG 303

Query: 178 AFVLVLYDEIKKVL 219
           +    + ++ K++L
Sbjct: 304 SIFFGVLEKTKQIL 317


>At1g25380.1 68414.m03150 mitochondrial substrate carrier family
           protein contains Pfam profile: PF00153 mitochondrial
           carrier protein
          Length = 363

 Score = 39.9 bits (89), Expect = 0.002
 Identities = 16/62 (25%), Positives = 32/62 (51%)
 Frame = +1

Query: 1   IISYPFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLRGTGGA 180
           I++YP + +R ++  Q     ++  Y   I C   + ++EG    ++G  +N+LR T  A
Sbjct: 233 ILTYPHEVIRAKLQEQGQIRNAETKYSGVIDCITKVFRSEGIPGLYRGCATNLLRTTPSA 292

Query: 181 FV 186
            +
Sbjct: 293 VI 294


>At4g32400.1 68417.m04613 mitochondrial substrate carrier family
           protein
          Length = 392

 Score = 39.1 bits (87), Expect = 0.003
 Identities = 21/72 (29%), Positives = 37/72 (51%), Gaps = 1/72 (1%)
 Frame = +1

Query: 7   SYPFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLRGTGGAFV 186
           ++P +  R+ M  Q G     ++YKN +H   TI + EG   ++KG   + L+    A +
Sbjct: 316 TFPLEVARKHM--QVGAVSGRVVYKNMLHALVTILEHEGILGWYKGLGPSCLKLVPAAGI 373

Query: 187 -LVLYDEIKKVL 219
             + Y+  KK+L
Sbjct: 374 SFMCYEACKKIL 385



 Score = 28.7 bits (61), Expect = 4.5
 Identities = 20/70 (28%), Positives = 34/70 (48%), Gaps = 1/70 (1%)
 Frame = +1

Query: 13  PFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLR-GTGGAFVL 189
           P +T+R  +M+ SG   S  ++ +       I K EG +  F+G   NV+R     A  L
Sbjct: 130 PLETIRTHLMVGSGGNSSTEVFSD-------IMKHEGWTGLFRGNLVNVIRVAPARAVEL 182

Query: 190 VLYDEIKKVL 219
            +++ + K L
Sbjct: 183 FVFETVNKKL 192


>At3g54110.1 68416.m05982 plant uncoupling mitochondrial protein
           (PUMP) identical to plant uncoupling mitochondrial
           protein [Arabidopsis thaliana] GI:3115108
          Length = 306

 Score = 39.1 bits (87), Expect = 0.003
 Identities = 24/71 (33%), Positives = 34/71 (47%), Gaps = 1/71 (1%)
 Frame = +1

Query: 4   ISYPFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLR-GTGGA 180
           I  P D V+ RMM  SG       YK TI C+    K++G   F+KG   N  R G+   
Sbjct: 231 IGSPVDVVKSRMMGDSGA------YKGTIDCFVKTLKSDGPMAFYKGFIPNFGRLGSWNV 284

Query: 181 FVLVLYDEIKK 213
            + +  ++ KK
Sbjct: 285 IMFLTLEQAKK 295


>At3g53940.1 68416.m05959 mitochondrial substrate carrier family
           protein
          Length = 365

 Score = 38.7 bits (86), Expect = 0.004
 Identities = 22/74 (29%), Positives = 39/74 (52%), Gaps = 3/74 (4%)
 Frame = +1

Query: 7   SYPFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKG---AFSNVLRGTGG 177
           ++P D VRRRM ++    ++ +        +  I KTEG    ++G    +  V+ G G 
Sbjct: 289 TFPLDLVRRRMQLEGAGGRARVYTTGLFGTFKHIFKTEGMRGLYRGIIPEYYKVVPGVGI 348

Query: 178 AFVLVLYDEIKKVL 219
           AF  + ++E+KK+L
Sbjct: 349 AF--MTFEELKKLL 360


>At2g37890.1 68415.m04651 mitochondrial substrate carrier family
           protein contains Pfam profile: PF00153 mitochondrial
           carrier protein
          Length = 337

 Score = 36.3 bits (80), Expect = 0.022
 Identities = 18/72 (25%), Positives = 34/72 (47%), Gaps = 1/72 (1%)
 Frame = +1

Query: 7   SYPFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLRGTGG-AF 183
           +YP D VRRRM ++    ++ +        +  I K+EG    ++G      +   G   
Sbjct: 261 TYPLDLVRRRMQVEGAGGRARVYNTGLFGTFKHIFKSEGFKGIYRGILPEYYKVVPGVGI 320

Query: 184 VLVLYDEIKKVL 219
           V + YD ++++L
Sbjct: 321 VFMTYDALRRLL 332


>At5g58970.2 68418.m07388 uncoupling protein (UCP2) identical to
           uncoupling protein GI:4063007 from [Arabidopsis
           thaliana]
          Length = 272

 Score = 35.1 bits (77), Expect = 0.052
 Identities = 23/78 (29%), Positives = 41/78 (52%), Gaps = 5/78 (6%)
 Frame = +1

Query: 1   IISYPFDTVRRRMMMQ----SGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLRG 168
           + + P DT + R+ +Q    +G  ++   Y+ +I   ATIA+ EG S  +KG  + + R 
Sbjct: 28  LCTIPLDTAKVRLQLQRKIPTGDGENLPKYRGSIGTLATIAREEGISGLWKGVIAGLHRQ 87

Query: 169 -TGGAFVLVLYDEIKKVL 219
              G   + LY+ +K +L
Sbjct: 88  CIYGGLRIGLYEPVKTLL 105


>At5g01500.1 68418.m00064 mitochondrial substrate carrier family
           protein contains Pfam profile: PF00153 mitochondrial
           carrier protein
          Length = 415

 Score = 34.7 bits (76), Expect = 0.068
 Identities = 19/71 (26%), Positives = 36/71 (50%), Gaps = 1/71 (1%)
 Frame = +1

Query: 10  YPFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLRGTGGAFV- 186
           YP DT+RR+M ++         YK+ +  ++ I   EG    ++G   N L+    + + 
Sbjct: 324 YPLDTIRRQMQLKG------TPYKSVLDAFSGIIAREGVVGLYRGFVPNALKSMPNSSIK 377

Query: 187 LVLYDEIKKVL 219
           L  +D +KK++
Sbjct: 378 LTTFDIVKKLI 388


>At4g01100.1 68417.m00148 mitochondrial substrate carrier family
           protein contains Pfam profile: PF00153 mitochondrial
           carrier protein
          Length = 352

 Score = 34.3 bits (75), Expect = 0.090
 Identities = 23/84 (27%), Positives = 36/84 (42%), Gaps = 12/84 (14%)
 Frame = +1

Query: 4   ISYPFDTVRRRMMM-----------QSGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAF 150
           I+YP D +RRRM M             GR+ + + Y   +  +    + EG    +KG  
Sbjct: 261 IAYPLDVIRRRMQMVGWKDASAIVTGEGRSTASLEYTGMVDAFRKTVRHEGFGALYKGLV 320

Query: 151 SNVLRGTGG-AFVLVLYDEIKKVL 219
            N ++     A   V Y+ +K VL
Sbjct: 321 PNSVKVVPSIAIAFVTYEMVKDVL 344


>At1g14560.1 68414.m01731 mitochondrial substrate carrier family
           protein contains Pfam profile: PF00153 mitochondrial
           carrier protein
          Length = 331

 Score = 34.3 bits (75), Expect = 0.090
 Identities = 19/58 (32%), Positives = 31/58 (53%), Gaps = 4/58 (6%)
 Frame = +1

Query: 4   ISYPFDTVRRRMMMQSGRAKS----DILYKNTIHCWATIAKTEGTSPFFKGAFSNVLR 165
           I+YP D VRR+M +++ +  +    +  YKNT     TI +T+G    F G   N ++
Sbjct: 244 ITYPLDVVRRQMQVENLQPMTSEGNNKRYKNTFDGLNTIVRTQGWKQLFAGLSINYIK 301


>At2g22500.1 68415.m02669 mitochondrial substrate carrier family
           protein contains Pfam profile: PF00153 mitochondrial
           carrier protein
          Length = 313

 Score = 33.1 bits (72), Expect = 0.21
 Identities = 21/73 (28%), Positives = 31/73 (42%), Gaps = 1/73 (1%)
 Frame = +1

Query: 1   IISYPFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLRGTGGA 180
           + S P D ++ R+M     A     YK  + C     K EG    +KG    V R     
Sbjct: 235 VASNPVDVIKTRVMNMKVVAGVAPPYKGAVDCALKTVKAEGIMSLYKGFIPTVSRQAPFT 294

Query: 181 FVL-VLYDEIKKV 216
            VL V  +++KK+
Sbjct: 295 VVLFVTLEQVKKL 307


>At1g14140.1 68414.m01671 mitochondrial substrate carrier family
           protein contains Pfam profile: PF00153 mitochondrial
           carrier protein
          Length = 305

 Score = 33.1 bits (72), Expect = 0.21
 Identities = 23/70 (32%), Positives = 32/70 (45%), Gaps = 1/70 (1%)
 Frame = +1

Query: 4   ISYPFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLRGTGGAF 183
           +S P D V+ RMM Q   A    +Y+N+  C     K EG    +KG F    R     F
Sbjct: 232 LSCPADVVKTRMMNQGENA----VYRNSYDCLVKTVKFEGIRALWKGFFPTWARLGPWQF 287

Query: 184 VL-VLYDEIK 210
           V  V Y++ +
Sbjct: 288 VFWVSYEKFR 297



 Score = 28.3 bits (60), Expect = 5.9
 Identities = 18/58 (31%), Positives = 27/58 (46%), Gaps = 3/58 (5%)
 Frame = +1

Query: 1   IISYPFDTVRRRMMMQSGRAKSDIL---YKNTIHCWATIAKTEGTSPFFKGAFSNVLR 165
           +++ P D V+ RM    GR  S  L   Y   I  +  I ++EG    +KG   N+ R
Sbjct: 130 VVASPADLVKVRMQAD-GRLVSQGLKPRYSGPIEAFTKILQSEGVKGLWKGVLPNIQR 186


>At3g51870.1 68416.m05688 mitochondrial substrate carrier family
           protein peroxisomal Ca-dependent solute carrier -
           Oryctolagus cuniculus, EMBL:AF004161
          Length = 381

 Score = 32.7 bits (71), Expect = 0.28
 Identities = 20/71 (28%), Positives = 35/71 (49%), Gaps = 1/71 (1%)
 Frame = +1

Query: 10  YPFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLRGTGGAFV- 186
           YP DTVRR+M M+         YK+    +A I   +G    ++G   N L+    + + 
Sbjct: 296 YPLDTVRRQMQMRG------TPYKSIPEAFAGIIDRDGLIGLYRGFLPNALKTLPNSSIR 349

Query: 187 LVLYDEIKKVL 219
           L  +D +K+++
Sbjct: 350 LTTFDMVKRLI 360


>At5g07320.1 68418.m00836 mitochondrial substrate carrier family
           protein similar to peroxisomal Ca-dependent solute
           carrier [Oryctolagus cuniculus] GI:2352427
           (mitochondrial carrier superfamily); contains
           INTERPRO:IPR001993 Mitochondrial substrate carrier
           family, INTERPRO:IPR002048 calcium-binding EF-hand
           domain
          Length = 479

 Score = 31.5 bits (68), Expect = 0.64
 Identities = 20/69 (28%), Positives = 32/69 (46%), Gaps = 1/69 (1%)
 Frame = +1

Query: 10  YPFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLRGTGGAFV- 186
           YP   VR RM   S +      + NT+       K EG   F++G   N+L+    A + 
Sbjct: 413 YPLQVVRTRMQADSSKTTMKQEFMNTM-------KGEGLRGFYRGLLPNLLKVVPAASIT 465

Query: 187 LVLYDEIKK 213
            ++Y+ +KK
Sbjct: 466 YIVYEAMKK 474


>At4g26180.1 68417.m03768 mitochondrial substrate carrier family
           protein contains Pfam profile: PF00153 mitochondrial
           carrier protein
          Length = 325

 Score = 31.1 bits (67), Expect = 0.84
 Identities = 21/71 (29%), Positives = 33/71 (46%), Gaps = 2/71 (2%)
 Frame = +1

Query: 4   ISYPFDTVRRRMMMQS-GRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLRGTGG- 177
           ++YP D VRR+M ++    A  +   + T+     IA+ EG    F G   N L+     
Sbjct: 230 LTYPLDVVRRQMQVERLYSAVKEETRRGTMQTLFKIAREEGWKQLFSGLSINYLKVVPSV 289

Query: 178 AFVLVLYDEIK 210
           A    +YD +K
Sbjct: 290 AIGFTVYDIMK 300


>At1g78180.1 68414.m09110 mitochondrial substrate carrier family
           protein contains Pfam profile: PF00153 mitochondrial
           carrier protein
          Length = 342

 Score = 29.9 bits (64), Expect = 1.9
 Identities = 11/25 (44%), Positives = 18/25 (72%)
 Frame = +1

Query: 1   IISYPFDTVRRRMMMQSGRAKSDIL 75
           + +YPF+ VRR++ MQ G+ K + L
Sbjct: 271 VATYPFEVVRRQLQMQMGKNKLNAL 295


>At5g46800.1 68418.m05766 mitochondrial carnitine/acyl carrier,
           putative / a bout de souffle (BOU) / CAC-like protein
           identical to SP|Q93XM7 Mitochondrial
           carnitine/acylcarnitine carrier-like protein (A BOUT DE
           SOUFFLE) (Carnitine/acylcarnitine translocase-like
           protein) (CAC-like protein) {Arabidopsis thaliana};
           contains Pfam profile: PF00153 mitochondrial carrier
           protein
          Length = 300

 Score = 29.1 bits (62), Expect = 3.4
 Identities = 18/67 (26%), Positives = 31/67 (46%), Gaps = 1/67 (1%)
 Frame = +1

Query: 1   IISYPFDTVRRRMMMQSGRAKSDI-LYKNTIHCWATIAKTEGTSPFFKGAFSNVLRGTGG 177
           ++ +PFDT++ ++  Q   A   +  Y   I        +EGT   +KG  + +   T  
Sbjct: 20  VVGHPFDTIKVKLQSQPTPAPGQLPRYTGAIDAVKQTVASEGTKGLYKGMGAPL--ATVA 77

Query: 178 AFVLVLY 198
           AF  VL+
Sbjct: 78  AFNAVLF 84


>At1g74240.1 68414.m08598 mitochondrial substrate carrier family
           protein contains Pfam profile: PF00153 mitochondrial
           carrier protein
          Length = 364

 Score = 29.1 bits (62), Expect = 3.4
 Identities = 16/53 (30%), Positives = 26/53 (49%)
 Frame = +1

Query: 4   ISYPFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVL 162
           ++ P D V+ R+ +Q     S I YK  +     I + EG   FF+G+   V+
Sbjct: 268 LTTPLDVVKTRLQVQG----STIKYKGWLDAVGQIWRKEGPQGFFRGSVPRVM 316


>At3g06370.1 68416.m00735 sodium proton exchanger, putative (NHX3)
           similar to sodium proton exchanger (Nhx1) GB:AAD16946
           [Arabidopsis thaliana]; Member of The Monovalent
           Cation:Proton Antiporter (CPA1) Family, PMID:11500563
          Length = 503

 Score = 28.3 bits (60), Expect = 5.9
 Identities = 12/30 (40%), Positives = 20/30 (66%)
 Frame = +2

Query: 605 NFMLKEVFNVLSILNLSFVGIENFHFFLHS 694
           ++ML E+F++ SIL + F GI   H+  H+
Sbjct: 264 SYMLAELFHLSSILTVFFCGIVMSHYTWHN 293


>At3g05420.2 68416.m00594 acyl-CoA binding family protein similar to
           PIR|S68824|S68824 rngB protein, cytosolic (Dictyostelium
           discoideum); contains Pfam profiles PF00887: Acyl CoA
           binding protein, PF01344: Kelch motif
          Length = 669

 Score = 28.3 bits (60), Expect = 5.9
 Identities = 15/51 (29%), Positives = 26/51 (50%)
 Frame = +1

Query: 46  QSGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLRGTGGAFVLVLY 198
           +SG ++S +L  +T+  W+ +A  +G  P      S V+    G  VLV +
Sbjct: 419 KSGASESVVLNMSTL-AWSVVASVQGRVPLASEGLSLVVSSYNGEDVLVAF 468


>At3g05420.1 68416.m00593 acyl-CoA binding family protein similar to
           PIR|S68824|S68824 rngB protein, cytosolic (Dictyostelium
           discoideum); contains Pfam profiles PF00887: Acyl CoA
           binding protein, PF01344: Kelch motif
          Length = 668

 Score = 28.3 bits (60), Expect = 5.9
 Identities = 15/51 (29%), Positives = 26/51 (50%)
 Frame = +1

Query: 46  QSGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLRGTGGAFVLVLY 198
           +SG ++S +L  +T+  W+ +A  +G  P      S V+    G  VLV +
Sbjct: 418 KSGASESVVLNMSTL-AWSVVASVQGRVPLASEGLSLVVSSYNGEDVLVAF 467


>At5g27150.1 68418.m03240 sodium proton exchanger / Na+/H+
           antiporter (NHX1) identical to Na+/H+ exchanger
           [Arabidopsis thaliana] gi|6650177|gb|AAF21755 and sodium
           proton exchanger Nhx1 [Arabidopsis thaliana]
           gi|4324597|gb|AAD16946; Member of The Monovalent
           Cation:Proton Antiporter (CPA1) Family, PMID:11500563
          Length = 538

 Score = 27.9 bits (59), Expect = 7.9
 Identities = 12/33 (36%), Positives = 21/33 (63%)
 Frame = +2

Query: 605 NFMLKEVFNVLSILNLSFVGIENFHFFLHSGSE 703
           ++ML E+F++  IL + F GI   H+  H+ +E
Sbjct: 261 SYMLAELFDLSGILTVFFCGIVMSHYTWHNVTE 293


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 15,030,320
Number of Sequences: 28952
Number of extensions: 277588
Number of successful extensions: 623
Number of sequences better than 10.0: 33
Number of HSP's better than 10.0 without gapping: 579
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 613
length of database: 12,070,560
effective HSP length: 80
effective length of database: 9,754,400
effective search space used: 1716774400
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).