SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS30022
         (834 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At1g18690.1 68414.m02332 galactosyl transferase GMA12/MNN10 fami...    32   0.41 
At4g36890.1 68417.m05230 glycosyl transferase family 43 protein ...    29   2.9  
At3g22120.1 68416.m02792 protease inhibitor/seed storage/lipid t...    28   6.6  
At1g51830.1 68414.m05843 leucine-rich repeat protein kinase, put...    28   6.6  
At1g63550.1 68414.m07184 hypothetical protein low similarity to ...    28   8.8  

>At1g18690.1 68414.m02332 galactosyl transferase GMA12/MNN10 family
           protein very low similarity to
           alpha-1,2-galactosyltransferase, Schizosaccharomyces
           pombe [SP|Q09174]
          Length = 632

 Score = 32.3 bits (70), Expect = 0.41
 Identities = 16/45 (35%), Positives = 23/45 (51%)
 Frame = +3

Query: 684 TSALQNRKFTFIKYQTQKESGWCYWPGALGGGLRPEGLRAEGLGR 818
           T ++ N+K  F  Y  + +  W   P    GGL P+G R+ G GR
Sbjct: 91  THSVSNKKTVFTDYSYKLDRVWIQVPS---GGLSPDGSRSSGSGR 132


>At4g36890.1 68417.m05230 glycosyl transferase family 43 protein low
           similarity to Galactosylgalactosylxylosylprotein
           3-beta-glucuronosyltransferase 1, Homo sapiens
           [SP|Q9P2W7], Rattus norvegicus [SP|O35789]; contains
           Pfam domain Glycosyltransferase family 43 [PF03360]
          Length = 525

 Score = 29.5 bits (63), Expect = 2.9
 Identities = 12/43 (27%), Positives = 20/43 (46%)
 Frame = +2

Query: 131 PVWLWPMAALNLQWDTATPLPEVTQEASALPLSAADTELLLWW 259
           P W+    +LN      +PL  +   +   PL +   ++LLWW
Sbjct: 381 PEWVKDFGSLNENEGVESPLSLLKDPSMVEPLGSCGRQVLLWW 423


>At3g22120.1 68416.m02792 protease inhibitor/seed storage/lipid
           transfer protein (LTP) family protein similar to
           SP|Q00451|PRF1_LYCES 36.4 kDa proline-rich protein
           Lycopersicon esculentum, proline-rich cell wall protein
           [Medicago sativa] GI:3818416; contains Pfam profile
           PF00234 Protease inhibitor/seed storage/LTP family
          Length = 334

 Score = 28.3 bits (60), Expect = 6.6
 Identities = 13/30 (43%), Positives = 14/30 (46%)
 Frame = -2

Query: 833 PPEVRPPKSFRPKSLRPKSTAQSPRPIAPT 744
           PP V+PPK    K   PK     P P  PT
Sbjct: 49  PPAVKPPKPPAVKPPTPKPPTVKPHPKPPT 78


>At1g51830.1 68414.m05843 leucine-rich repeat protein kinase,
           putative similar to light repressible receptor protein
           kinase GI:1321686 from [Arabidopsis thaliana]
          Length = 675

 Score = 28.3 bits (60), Expect = 6.6
 Identities = 18/56 (32%), Positives = 25/56 (44%), Gaps = 1/56 (1%)
 Frame = +2

Query: 137 WLWPMAALNLQWDTATPLPEVTQEASALPLSAADTELLLWWSFWIPRWPFWRQ-HF 301
           W      LN+   T   LP+     +A PL+A  T L + W+   P  PF+   HF
Sbjct: 29  WTQVTTNLNVNISTIYELPQSVMSTAATPLNANAT-LNITWTIEPPTTPFYSYIHF 83


>At1g63550.1 68414.m07184 hypothetical protein low similarity to
           receptor-like protein kinase 5 [Arabidopsis thaliana]
           GI:13506747; contains Pfam profile: PF01657 Domain of
           unknown function DUF26
          Length = 299

 Score = 27.9 bits (59), Expect = 8.8
 Identities = 12/25 (48%), Positives = 14/25 (56%)
 Frame = -2

Query: 830 PEVRPPKSFRPKSLRPKSTAQSPRP 756
           P   PP+S  PKS  P S  Q+P P
Sbjct: 230 PSAPPPRSPPPKSSPPSSLPQTPSP 254


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 15,286,051
Number of Sequences: 28952
Number of extensions: 286151
Number of successful extensions: 1098
Number of sequences better than 10.0: 5
Number of HSP's better than 10.0 without gapping: 1002
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1098
length of database: 12,070,560
effective HSP length: 80
effective length of database: 9,754,400
effective search space used: 1921616800
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).