SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS30019
         (719 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At1g31850.3 68414.m03915 dehydration-responsive protein, putativ...    29   4.1  
At1g31850.2 68414.m03914 dehydration-responsive protein, putativ...    29   4.1  
At1g31850.1 68414.m03913 dehydration-responsive protein, putativ...    29   4.1  
At3g45540.1 68416.m04918 zinc finger (C3HC4-type RING finger) fa...    27   9.5  
At2g43560.1 68415.m05412 immunophilin / FKBP-type peptidyl-proly...    27   9.5  

>At1g31850.3 68414.m03915 dehydration-responsive protein, putative
           strong similarity to early-responsive to dehydration
           stress ERD3 protein [Arabidopsis thaliana] GI:15320410;
           contains Pfam profile PF03141: Putative
           methyltransferase
          Length = 603

 Score = 28.7 bits (61), Expect = 4.1
 Identities = 16/50 (32%), Positives = 20/50 (40%)
 Frame = +3

Query: 186 PRGPCSVPGRPSCLPRGPCSVPGAPVAYHTSPLRYSSAESVSSQNIVRHD 335
           P  PC V   P     G  S+P  P   H +P R        S N ++HD
Sbjct: 383 PLRPCVVAPTPKVKKSGLGSIPKWPERLHVAPERIGDVHG-GSANSLKHD 431


>At1g31850.2 68414.m03914 dehydration-responsive protein, putative
           strong similarity to early-responsive to dehydration
           stress ERD3 protein [Arabidopsis thaliana] GI:15320410;
           contains Pfam profile PF03141: Putative
           methyltransferase
          Length = 603

 Score = 28.7 bits (61), Expect = 4.1
 Identities = 16/50 (32%), Positives = 20/50 (40%)
 Frame = +3

Query: 186 PRGPCSVPGRPSCLPRGPCSVPGAPVAYHTSPLRYSSAESVSSQNIVRHD 335
           P  PC V   P     G  S+P  P   H +P R        S N ++HD
Sbjct: 383 PLRPCVVAPTPKVKKSGLGSIPKWPERLHVAPERIGDVHG-GSANSLKHD 431


>At1g31850.1 68414.m03913 dehydration-responsive protein, putative
           strong similarity to early-responsive to dehydration
           stress ERD3 protein [Arabidopsis thaliana] GI:15320410;
           contains Pfam profile PF03141: Putative
           methyltransferase
          Length = 603

 Score = 28.7 bits (61), Expect = 4.1
 Identities = 16/50 (32%), Positives = 20/50 (40%)
 Frame = +3

Query: 186 PRGPCSVPGRPSCLPRGPCSVPGAPVAYHTSPLRYSSAESVSSQNIVRHD 335
           P  PC V   P     G  S+P  P   H +P R        S N ++HD
Sbjct: 383 PLRPCVVAPTPKVKKSGLGSIPKWPERLHVAPERIGDVHG-GSANSLKHD 431


>At3g45540.1 68416.m04918 zinc finger (C3HC4-type RING finger)
           family protein contains a Prosite:PS00518 Zinc finger,
           C3HC4 type (RING finger), signature
          Length = 348

 Score = 27.5 bits (58), Expect = 9.5
 Identities = 15/39 (38%), Positives = 17/39 (43%), Gaps = 1/39 (2%)
 Frame = +3

Query: 150 RCQARCCYPCSLPRGPCS-VPGRPSCLPRGPCSVPGAPV 263
           RC  + CY C +  G C    G P   P  P S P  PV
Sbjct: 283 RCGHKFCYRCGVQAGGCKHGHGLPPRPPPPPPSPPPTPV 321


>At2g43560.1 68415.m05412 immunophilin / FKBP-type peptidyl-prolyl
           cis-trans isomerase family protein identical to Probable
           FKBP-type peptidyl-prolyl cis-trans isomerase 2,
           chloroplast precursor (Ppiase) (Rotamase)
           (SP:O22870)[Arabidopsis thaliana]; contains Pfam
           PF00254: peptidyl-prolyl cis-trans isomerase, FKBP-type
          Length = 223

 Score = 27.5 bits (58), Expect = 9.5
 Identities = 10/22 (45%), Positives = 12/22 (54%)
 Frame = +3

Query: 174 PCSLPRGPCSVPGRPSCLPRGP 239
           P + P+G  S PGRP   P  P
Sbjct: 184 PLAFPKGLVSAPGRPRVAPNSP 205


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 13,151,069
Number of Sequences: 28952
Number of extensions: 224483
Number of successful extensions: 651
Number of sequences better than 10.0: 5
Number of HSP's better than 10.0 without gapping: 635
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 651
length of database: 12,070,560
effective HSP length: 79
effective length of database: 9,783,352
effective search space used: 1565336320
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).