SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS30015
         (660 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At5g48760.1 68418.m06034 60S ribosomal protein L13A (RPL13aD)         136   2e-32
At3g07110.1 68416.m00847 60S ribosomal protein L13A (RPL13aA) si...   135   3e-32
At3g24830.1 68416.m03115 60S ribosomal protein L13A (RPL13aB) si...   132   3e-31
At4g13170.1 68417.m02049 60S ribosomal protein L13A (RPL13aC) ri...   131   3e-31
At1g61500.1 68414.m06929 S-locus protein kinase, putative simila...    29   3.6  
At1g61420.1 68414.m06921 S-locus lectin protein kinase family pr...    29   3.6  
At1g61380.1 68414.m06917 S-locus protein kinase, putative simila...    29   3.6  
At3g10270.1 68416.m01231 DNA topoisomerase, ATP-hydrolyzing, put...    28   4.8  
At1g61490.1 68414.m06928 S-locus protein kinase, putative simila...    28   4.8  
At1g61460.1 68414.m06925 S-locus protein kinase, putative contai...    28   4.8  
At5g48410.1 68418.m05986 glutamate receptor family protein (GLR1...    28   6.3  
At1g58090.1 68414.m06583 F-box family protein contains F-box dom...    28   6.3  
At5g11250.1 68418.m01314 disease resistance protein (TIR-NBS-LRR...    27   8.4  
At5g03330.2 68418.m00285 OTU-like cysteine protease family prote...    27   8.4  
At5g03330.1 68418.m00284 OTU-like cysteine protease family prote...    27   8.4  
At1g49260.1 68414.m05523 hypothetical protein                          27   8.4  

>At5g48760.1 68418.m06034 60S ribosomal protein L13A (RPL13aD)
          Length = 206

 Score =  136 bits (328), Expect = 2e-32
 Identities = 69/164 (42%), Positives = 88/164 (53%)
 Frame = +3

Query: 3   GFSNKAIVIDGRGHLLGRLAAVIAKVLLEGNKVVVVRCEQINISGNFFRNKLKLMSFLRK 182
           G  +K +V+D R H+LGRLA++ AK LL G KVV+VRCE+I +SG   R K+K M FLRK
Sbjct: 6   GICSKRVVVDARHHMLGRLASITAKELLNGQKVVIVRCEEICLSGGLVRQKMKYMRFLRK 65

Query: 183 RCNVNPARGPFHFRAPSKILWKTVEA*SHTKQSVARMLLGGYVHMMGALLPLITXXXXXX 362
           R N  P+ GP HFRAPSKI W+TV      K       L       G   P         
Sbjct: 66  RMNTKPSHGPIHFRAPSKIFWRTVRGMIPHKTKRGAAALARLKVYEGVPTPYDKIKRMVI 125

Query: 363 XXXXXXXXXXXXXXXCHVGRLSHEIGWKYRDVVRKLEDKRKGKA 494
                          C +GRLS E+GW + D +++LE KRK +A
Sbjct: 126 PDALKVLRLQAGHKYCLLGRLSSEVGWNHYDTIKELETKRKERA 169


>At3g07110.1 68416.m00847 60S ribosomal protein L13A (RPL13aA)
           similar to ribosomal protein L13A GB:O49885 [Lupinus
           luteus]
          Length = 206

 Score =  135 bits (326), Expect = 3e-32
 Identities = 69/164 (42%), Positives = 88/164 (53%)
 Frame = +3

Query: 3   GFSNKAIVIDGRGHLLGRLAAVIAKVLLEGNKVVVVRCEQINISGNFFRNKLKLMSFLRK 182
           G   K +V+D R H+LGRLA+V+AK LL G  +VVVRCE+I +SG   R K+K M FLRK
Sbjct: 6   GICAKRVVVDARHHMLGRLASVVAKDLLNGQNIVVVRCEEICLSGGLVRQKMKYMRFLRK 65

Query: 183 RCNVNPARGPFHFRAPSKILWKTVEA*SHTKQSVARMLLGGYVHMMGALLPLITXXXXXX 362
           R N  P+ GP HFRAPSKI W+TV      K       L       G   P         
Sbjct: 66  RMNTKPSHGPIHFRAPSKIFWRTVRGMIPHKTKRGANALARLKVFEGVPTPYDKIKRMVV 125

Query: 363 XXXXXXXXXXXXXXXCHVGRLSHEIGWKYRDVVRKLEDKRKGKA 494
                          C +GRLS E+GW + D +++LE+KRK +A
Sbjct: 126 PDALKVLRLQAGHKYCLLGRLSSEVGWNHYDTIKELENKRKERA 169


>At3g24830.1 68416.m03115 60S ribosomal protein L13A (RPL13aB)
           similar to 60S RIBOSOMAL PROTEIN L13A GB:P35427 from
           [Rattus norvegicus]
          Length = 206

 Score =  132 bits (318), Expect = 3e-31
 Identities = 68/164 (41%), Positives = 87/164 (53%)
 Frame = +3

Query: 3   GFSNKAIVIDGRGHLLGRLAAVIAKVLLEGNKVVVVRCEQINISGNFFRNKLKLMSFLRK 182
           G  +K +V+D R H+ GRLA++IAK LL G  VVVVRCE+I +SG   R K+K M FLRK
Sbjct: 6   GICSKRVVVDARHHMCGRLASIIAKELLNGQSVVVVRCEEICLSGGLVRQKMKYMRFLRK 65

Query: 183 RCNVNPARGPFHFRAPSKILWKTVEA*SHTKQSVARMLLGGYVHMMGALLPLITXXXXXX 362
           R N  P+ GP HFRAPSKI W+TV      K       L       G   P         
Sbjct: 66  RMNTKPSHGPIHFRAPSKIFWRTVRGMIPHKTKRGAAALARLKVFEGVPPPYDKVKRMVI 125

Query: 363 XXXXXXXXXXXXXXXCHVGRLSHEIGWKYRDVVRKLEDKRKGKA 494
                          C +GRLS E+GW + D +++LE KRK ++
Sbjct: 126 PDALKVLRLQAGHKYCLLGRLSSEVGWNHYDTIKELEVKRKERS 169


>At4g13170.1 68417.m02049 60S ribosomal protein L13A (RPL13aC)
           ribosomal protein L13a -Lupinus luteus,PID:e1237871
          Length = 206

 Score =  131 bits (317), Expect = 3e-31
 Identities = 69/164 (42%), Positives = 87/164 (53%)
 Frame = +3

Query: 3   GFSNKAIVIDGRGHLLGRLAAVIAKVLLEGNKVVVVRCEQINISGNFFRNKLKLMSFLRK 182
           G   K +V+DGR H+LGRLA+  AK LL G +VVVVRCE+I +SG   R K+K M FLRK
Sbjct: 6   GICAKRVVVDGRHHMLGRLASNTAKELLNGQEVVVVRCEEICLSGGLVRQKMKYMRFLRK 65

Query: 183 RCNVNPARGPFHFRAPSKILWKTVEA*SHTKQSVARMLLGGYVHMMGALLPLITXXXXXX 362
           R N  P+ GP HFRAPSKI W+TV      K       L       G   P         
Sbjct: 66  RMNTKPSHGPIHFRAPSKIFWRTVRGMIPHKTKRGAAALARLKVFEGIPPPYDKIKRMVI 125

Query: 363 XXXXXXXXXXXXXXXCHVGRLSHEIGWKYRDVVRKLEDKRKGKA 494
                          C +GRLS E+GW + D +++LE KRK ++
Sbjct: 126 PDALKVLRLQSGHKYCLLGRLSSEVGWNHYDTIKELETKRKERS 169



 Score = 49.2 bits (112), Expect = 2e-06
 Identities = 19/29 (65%), Positives = 24/29 (82%)
 Frame = +2

Query: 254 RGMIPHKTERGKNALRRLRTYDGCPPPFD 340
           RGMIPHKT+RG  AL RL+ ++G PPP+D
Sbjct: 90  RGMIPHKTKRGAAALARLKVFEGIPPPYD 118


>At1g61500.1 68414.m06929 S-locus protein kinase, putative similar
           to KI domain interacting kinase 1 [Zea mays]
           gi|2735017|gb|AAB93834; contains S-locus glycoprotein
           family domain, Pfam:PF00954
          Length = 804

 Score = 28.7 bits (61), Expect = 3.6
 Identities = 21/90 (23%), Positives = 42/90 (46%)
 Frame = -2

Query: 524 LSFFSWHSLNSLALPLVFKLTNNITVFPSNFMGQSAYMTVIYGQVLDRRHVEQQALQHVD 345
           L FF  H++ +         TNN ++  SN +GQ  + +V  G++ D + +  + L    
Sbjct: 476 LDFFDMHTIQNA--------TNNFSL--SNKLGQGGFGSVYKGKLQDGKEIAVKRLSSSS 525

Query: 344 GYQREEGTHHMYVAS*EHSCHALFCVGSCL 255
           G  +EE  + + + S     + +  +G C+
Sbjct: 526 GQGKEEFMNEIVLISKLQHRNLVRVLGCCI 555


>At1g61420.1 68414.m06921 S-locus lectin protein kinase family
           protein contains Pfam domains, PF00954: S-locus
           glycoprotein family, PF00069: Protein kinase domain, and
           PF01453: Lectin (probable mannose binding)
          Length = 807

 Score = 28.7 bits (61), Expect = 3.6
 Identities = 21/90 (23%), Positives = 41/90 (45%)
 Frame = -2

Query: 524 LSFFSWHSLNSLALPLVFKLTNNITVFPSNFMGQSAYMTVIYGQVLDRRHVEQQALQHVD 345
           L FF  H++ +         TNN ++  SN +GQ  +  V  G++ D + +  + L    
Sbjct: 479 LDFFDMHTIQTA--------TNNFSI--SNKLGQGGFGPVYKGKLQDGKEIAVKRLSSSS 528

Query: 344 GYQREEGTHHMYVAS*EHSCHALFCVGSCL 255
           G  +EE  + + + S     + +  +G C+
Sbjct: 529 GQGKEEFMNEIVLISKLQHKNLVRILGCCI 558


>At1g61380.1 68414.m06917 S-locus protein kinase, putative similar
           to KI domain interacting kinase 1 [Zea mays]
           gi|2735017|gb|AAB93834; contains S-locus glycoprotein
           family domain, Pfam:PF00954
          Length = 805

 Score = 28.7 bits (61), Expect = 3.6
 Identities = 19/82 (23%), Positives = 38/82 (46%)
 Frame = -2

Query: 500 LNSLALPLVFKLTNNITVFPSNFMGQSAYMTVIYGQVLDRRHVEQQALQHVDGYQREEGT 321
           +N   +  +   TNN +  PSN +GQ  +  V  G+++D + +  + L    G   EE  
Sbjct: 473 VNFFEMHTIRTATNNFS--PSNKLGQGGFGPVYKGKLVDGKEIGVKRLASSSGQGTEEFM 530

Query: 320 HHMYVAS*EHSCHALFCVGSCL 255
           + + + S     + +  +G C+
Sbjct: 531 NEITLISKLQHRNLVRLLGYCI 552


>At3g10270.1 68416.m01231 DNA topoisomerase, ATP-hydrolyzing,
           putative / DNA topoisomerase II, putative / DNA gyrase,
           putative similar to SP|O50627 DNA gyrase subunit B (EC
           5.99.1.3) {Bacillus halodurans}; contains Pfam profiles
           PF02518: ATPase, histidine kinase-, DNA gyrase B-, and
           HSP90-like domain protein, PF00204: DNA topoisomerase II
           (N-terminal region), PF00986: DNA gyrase, B subunit,
           carboxyl terminus, PF01751: Toprim domain
          Length = 657

 Score = 28.3 bits (60), Expect = 4.8
 Identities = 15/52 (28%), Positives = 27/52 (51%)
 Frame = +3

Query: 3   GFSNKAIVIDGRGHLLGRLAAVIAKVLLEGNKVVVVRCEQINISGNFFRNKL 158
           G++N    IDG  H+ G  A++   +     K+ V++ + I++SG   R  L
Sbjct: 288 GYANSIRTIDGGTHIEGVKASLTRTLNSLAKKLKVIKEKDISLSGEHVREGL 339


>At1g61490.1 68414.m06928 S-locus protein kinase, putative similar
           to KI domain interacting kinase 1 [Zea mays]
           gi|2735017|gb|AAB93834; contains S-locus glycoprotein
           family domain, Pfam:PF00954
          Length = 804

 Score = 28.3 bits (60), Expect = 4.8
 Identities = 17/70 (24%), Positives = 35/70 (50%)
 Frame = -2

Query: 464 TNNITVFPSNFMGQSAYMTVIYGQVLDRRHVEQQALQHVDGYQREEGTHHMYVAS*EHSC 285
           TNN ++  SN +GQ  + +V  G++ D + +  + L    G  +EE  + + + S     
Sbjct: 487 TNNFSL--SNKLGQGGFGSVYKGKLQDGKEIAVKQLSSSSGQGKEEFMNEIVLISKLQHR 544

Query: 284 HALFCVGSCL 255
           + +  +G C+
Sbjct: 545 NLVRVLGCCI 554


>At1g61460.1 68414.m06925 S-locus protein kinase, putative contains
           similarity to KI domain interacting kinase 1 [Zea mays]
           gi|2735017|gb|AAB93834; contains S-locus glycoprotein
           family domain, Pfam:PF00954
          Length = 598

 Score = 28.3 bits (60), Expect = 4.8
 Identities = 17/70 (24%), Positives = 35/70 (50%)
 Frame = -2

Query: 464 TNNITVFPSNFMGQSAYMTVIYGQVLDRRHVEQQALQHVDGYQREEGTHHMYVAS*EHSC 285
           TNN ++  SN +GQ  + +V  G++ D + +  + L    G  +EE  + + + S     
Sbjct: 300 TNNFSL--SNKLGQGGFGSVYKGKLQDGKEIAVKRLSSSSGQGKEEFMNEIVLISKLQHK 357

Query: 284 HALFCVGSCL 255
           + +  +G C+
Sbjct: 358 NLVRILGCCI 367


>At5g48410.1 68418.m05986 glutamate receptor family protein (GLR1.3)
           plant glutamate receptor family, PMID:11379626
          Length = 860

 Score = 27.9 bits (59), Expect = 6.3
 Identities = 14/50 (28%), Positives = 25/50 (50%), Gaps = 3/50 (6%)
 Frame = -2

Query: 647 GFIFWL*FLKSLNCIHRNLDDGSEMVF---VAFDTFSPASLVILLSFFSW 507
           GF+ W+   K++N  H N+DD ++      V F ++ P S+ +      W
Sbjct: 259 GFV-WILTAKTMNSFHENIDDFTKQAMEGVVGFKSYIPMSIELQNFTLRW 307


>At1g58090.1 68414.m06583 F-box family protein contains F-box domain
           Pfam:PF00646
          Length = 371

 Score = 27.9 bits (59), Expect = 6.3
 Identities = 13/29 (44%), Positives = 18/29 (62%)
 Frame = -2

Query: 596 NLDDGSEMVFVAFDTFSPASLVILLSFFS 510
           N DDG ++V++ F T S     ILLS+ S
Sbjct: 282 NGDDGDDVVWIKFMTVSRPDFPILLSYIS 310


>At5g11250.1 68418.m01314 disease resistance protein (TIR-NBS-LRR
           class), putative domain signature TIR-NBS-LRR exists,
           suggestive of a disease resistance protein.
          Length = 1189

 Score = 27.5 bits (58), Expect = 8.4
 Identities = 16/39 (41%), Positives = 25/39 (64%)
 Frame = -3

Query: 244 HRILDGALKWKGPRAGFTLHLLRRNDISLSLFLKKLPEI 128
           H  LD  + W+G +    LH LR+ D+S S+ LK+LP++
Sbjct: 662 HSKLD--MLWEGVKP---LHNLRQMDLSYSVNLKELPDL 695


>At5g03330.2 68418.m00285 OTU-like cysteine protease family protein
           contains Pfam profile PF02338: OTU-like cysteine
           protease
          Length = 356

 Score = 27.5 bits (58), Expect = 8.4
 Identities = 14/50 (28%), Positives = 25/50 (50%)
 Frame = +3

Query: 147 RNKLKLMSFLRKRCNVNPARGPFHFRAPSKILWKTVEA*SHTKQSVARML 296
           RN+L++  F   +    P  G   FRA +  L+KT +   H ++ + + L
Sbjct: 205 RNRLEMFDFTEVKV---PGDGNCQFRALADQLYKTADRHKHVRRQIVKQL 251


>At5g03330.1 68418.m00284 OTU-like cysteine protease family protein
           contains Pfam profile PF02338: OTU-like cysteine
           protease
          Length = 356

 Score = 27.5 bits (58), Expect = 8.4
 Identities = 14/50 (28%), Positives = 25/50 (50%)
 Frame = +3

Query: 147 RNKLKLMSFLRKRCNVNPARGPFHFRAPSKILWKTVEA*SHTKQSVARML 296
           RN+L++  F   +    P  G   FRA +  L+KT +   H ++ + + L
Sbjct: 205 RNRLEMFDFTEVKV---PGDGNCQFRALADQLYKTADRHKHVRRQIVKQL 251


>At1g49260.1 68414.m05523 hypothetical protein
          Length = 149

 Score = 27.5 bits (58), Expect = 8.4
 Identities = 10/28 (35%), Positives = 14/28 (50%)
 Frame = -3

Query: 298 KSILATLCFVWDHASTVFHRILDGALKW 215
           K+I+ T C  W H +T   RI +    W
Sbjct: 64  KAIITTCCSAWFHLTTYQERIEESLFSW 91


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 15,089,862
Number of Sequences: 28952
Number of extensions: 314997
Number of successful extensions: 858
Number of sequences better than 10.0: 16
Number of HSP's better than 10.0 without gapping: 833
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 852
length of database: 12,070,560
effective HSP length: 78
effective length of database: 9,812,304
effective search space used: 1383534864
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).