SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS30014
         (611 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At5g02490.1 68418.m00182 heat shock cognate 70 kDa protein 2 (HS...   133   1e-31
At5g02500.1 68418.m00183 heat shock cognate 70 kDa protein 1 (HS...   131   3e-31
At3g09440.1 68416.m01121 heat shock cognate 70 kDa protein 3 (HS...   131   4e-31
At3g12580.1 68416.m01567 heat shock protein 70, putative / HSP70...   128   2e-30
At1g16030.1 68414.m01924 heat shock protein 70, putative / HSP70...   124   5e-29
At1g56410.1 68414.m06487 heat shock cognate 70 kDa protein, puta...   109   1e-24
At5g42020.1 68418.m05115 luminal binding protein 2 (BiP-2) (BP2)...   107   4e-24
At5g28540.1 68418.m03480 luminal binding protein 1 (BiP-1) (BP1)...   105   2e-23
At1g09080.1 68414.m01013 luminal binding protein 3 (BiP-3) (BP3)...    99   2e-21
At5g09590.1 68418.m01110 heat shock protein 70 / HSP70 (HSC70-5)...    97   8e-21
At4g37910.1 68417.m05361 heat shock protein 70, mitochondrial, p...    97   1e-20
At4g24280.1 68417.m03486 heat shock protein 70, putative / HSP70...    93   1e-19
At5g49910.1 68418.m06180 heat shock protein 70 / HSP70 (HSC70-7)...    91   7e-19
At5g42020.2 68418.m05116 luminal binding protein 2 (BiP-2) (BP2)...    84   6e-17
At2g32120.2 68415.m03926 heat shock protein 70 family protein / ...    70   1e-12
At2g32120.1 68415.m03925 heat shock protein 70 family protein / ...    70   1e-12
At5g09400.1 68418.m01089 potassium transporter family protein si...    32   0.34 
At5g55670.1 68418.m06941 RNA recognition motif (RRM)-containing ...    31   0.60 
At1g33770.1 68414.m04174 protein kinase family protein contains ...    29   2.4  
At1g29000.1 68414.m03546 heavy-metal-associated domain-containin...    29   2.4  
At2g18540.1 68415.m02160 cupin family protein contains Pfam prof...    29   3.2  
At3g15560.1 68416.m01972 expressed protein                             28   4.2  
At2g42010.1 68415.m05197 phospholipase D beta 1 / PLD beta 1 (PL...    28   4.2  
At2g12900.1 68415.m01408 hypothetical protein similar to transcr...    28   4.2  
At3g55150.1 68416.m06125 exocyst subunit EXO70 family protein co...    27   7.4  
At2g43970.2 68415.m05468 La domain-containing protein contains P...    27   7.4  
At2g43970.1 68415.m05467 La domain-containing protein contains P...    27   7.4  
At5g62310.1 68418.m07822 incomplete root hair elongation (IRE) /...    27   9.8  
At4g31800.1 68417.m04517 WRKY family transcription factor              27   9.8  
At1g73010.1 68414.m08443 expressed protein similar to phosphatas...    27   9.8  
At1g55600.1 68414.m06364 WRKY family transcription factor simila...    27   9.8  
At1g01350.1 68414.m00050 zinc finger (CCCH-type/C3HC4-type RING ...    27   9.8  

>At5g02490.1 68418.m00182 heat shock cognate 70 kDa protein 2
           (HSC70-2) (HSP70-2) identical to SP|P22954 Heat shock
           cognate 70 kDa protein 2 (Hsc70.2) {Arabidopsis
           thaliana}
          Length = 653

 Score =  133 bits (321), Expect = 1e-31
 Identities = 71/142 (50%), Positives = 93/142 (65%)
 Frame = +2

Query: 47  YSDNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSA 226
           YSDNQPGVLIQVFEGERA TKDNNLLGKFEL+GIPPAPRGVPQI V FDIDANGILNVSA
Sbjct: 437 YSDNQPGVLIQVFEGERARTKDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSA 496

Query: 227 IEKSTNKENRSPLPTTKVVSPRKRSSVWLMRQRSTETRMTRQKETIQGQECIGILLASA* 406
            +K+T K+N+  +   K    ++     +      ++     K+ ++ +  +     +  
Sbjct: 497 EDKTTGKKNKITITNDKGRLSKEDIEKMVQEAEKYKSEDEEHKKKVEAKNALENYAYNM- 555

Query: 407 SATMEDEKLKEKILLNSDKQTI 472
             T+ DEK+ EK L  +DK+ +
Sbjct: 556 RNTIRDEKIGEK-LPAADKKKV 576


>At5g02500.1 68418.m00183 heat shock cognate 70 kDa protein 1
           (HSC70-1) (HSP70-1) identical to SP|P22953 Heat shock
           cognate 70 kDa protein 1 (Hsc70.1) {Arabidopsis
           thaliana}
          Length = 651

 Score =  131 bits (317), Expect = 3e-31
 Identities = 70/142 (49%), Positives = 93/142 (65%)
 Frame = +2

Query: 47  YSDNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSA 226
           YSDNQPGVLIQV+EGERA TKDNNLLGKFEL+GIPPAPRGVPQI V FDIDANGILNVSA
Sbjct: 437 YSDNQPGVLIQVYEGERARTKDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSA 496

Query: 227 IEKSTNKENRSPLPTTKVVSPRKRSSVWLMRQRSTETRMTRQKETIQGQECIGILLASA* 406
            +K+T ++N+  +   K    +      +      ++     K+ ++ +  +     +  
Sbjct: 497 EDKTTGQKNKITITNDKGRLSKDEIEKMVQEAEKYKSEDEEHKKKVEAKNALENYAYNM- 555

Query: 407 SATMEDEKLKEKILLNSDKQTI 472
             T++DEK+ EK L  +DK+ I
Sbjct: 556 RNTIQDEKIGEK-LPAADKKKI 576


>At3g09440.1 68416.m01121 heat shock cognate 70 kDa protein 3
           (HSC70-3) (HSP70-3) identical to SP|O65719 Heat shock
           cognate 70 kDa protein 3 (Hsc70.3) {Arabidopsis
           thaliana}
          Length = 649

 Score =  131 bits (316), Expect = 4e-31
 Identities = 70/142 (49%), Positives = 90/142 (63%)
 Frame = +2

Query: 47  YSDNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSA 226
           YSDNQPGVLIQV+EGERA TKDNNLLGKFEL+GIPPAPRGVPQI V FDIDANGILNVSA
Sbjct: 437 YSDNQPGVLIQVYEGERARTKDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSA 496

Query: 227 IEKSTNKENRSPLPTTKVVSPRKRSSVWLMRQRSTETRMTRQKETIQGQECIGILLASA* 406
            +K+T ++N+  +   K    +      +      ++     K+ +  +  +     +  
Sbjct: 497 EDKTTGQKNKITITNDKGRLSKDEIEKMVQEAEKYKSEDEEHKKKVDAKNALENYAYNM- 555

Query: 407 SATMEDEKLKEKILLNSDKQTI 472
             T+ DEK+ EK L   DK+ I
Sbjct: 556 RNTIRDEKIGEK-LAGDDKKKI 576


>At3g12580.1 68416.m01567 heat shock protein 70, putative / HSP70,
           putative strong similarity to heat shock protein
           GI:425194 [Spinacia oleracea]
          Length = 650

 Score =  128 bits (310), Expect = 2e-30
 Identities = 69/142 (48%), Positives = 91/142 (64%)
 Frame = +2

Query: 47  YSDNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSA 226
           YSDNQPGVLIQV+EGERA TKDNNLLGKFEL+GIPPAPRGVPQI V FDIDANGILNVSA
Sbjct: 437 YSDNQPGVLIQVYEGERARTKDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSA 496

Query: 227 IEKSTNKENRSPLPTTKVVSPRKRSSVWLMRQRSTETRMTRQKETIQGQECIGILLASA* 406
            +K+T ++N+  +   K    ++     +      +      K+ +  +  +     +  
Sbjct: 497 EDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKAEDEEHKKKVDAKNALENYAYNM- 555

Query: 407 SATMEDEKLKEKILLNSDKQTI 472
             T++DEK+  K L  +DK+ I
Sbjct: 556 RNTIKDEKIASK-LDAADKKKI 576


>At1g16030.1 68414.m01924 heat shock protein 70, putative / HSP70,
           putative similar to heat shock protein hsp70 GI:1771478
           from [Pisum sativum]
          Length = 646

 Score =  124 bits (299), Expect = 5e-29
 Identities = 67/144 (46%), Positives = 90/144 (62%)
 Frame = +2

Query: 47  YSDNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSA 226
           Y+DNQPGVLIQV+EGERA T+DNNLLG FEL GIPPAPRGVPQI V FDIDANGILNVSA
Sbjct: 436 YADNQPGVLIQVYEGERARTRDNNLLGTFELKGIPPAPRGVPQINVCFDIDANGILNVSA 495

Query: 227 IEKSTNKENRSPLPTTKVVSPRKRSSVWLMRQRSTETRMTRQKETIQGQECIGILLASA* 406
            +K+   +N+  +   K    ++     +      +    + K+ ++ +  +     +  
Sbjct: 496 EDKTAGVKNQITITNDKGRLSKEEIEKMVQDAEKYKAEDEQVKKKVEAKNSLENYAYNM- 554

Query: 407 SATMEDEKLKEKILLNSDKQTIPR 478
             T++DEKL +K L   DKQ I +
Sbjct: 555 RNTIKDEKLAQK-LTQEDKQKIEK 577


>At1g56410.1 68414.m06487 heat shock cognate 70 kDa protein,
           putative / HSC70, putative / HSP70, putative strong
           similarity to heat shock cognate 70 kd protein 1
           SP:P22953 [Arabidopsis thaliana (Mouse-ear cress)]
          Length = 617

 Score =  109 bits (263), Expect = 1e-24
 Identities = 50/75 (66%), Positives = 61/75 (81%)
 Frame = +2

Query: 53  DNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSAIE 232
           DNQP VLIQV+EGERA T DNN+LG+F L+GIPPAPRG+PQ  V FDID+NGILNVSA +
Sbjct: 439 DNQPDVLIQVYEGERARTIDNNILGQFVLSGIPPAPRGIPQFTVCFDIDSNGILNVSAED 498

Query: 233 KSTNKENRSPLPTTK 277
           K+T K+N+  +   K
Sbjct: 499 KATGKKNKITITNDK 513



 Score = 56.4 bits (130), Expect = 1e-08
 Identities = 24/34 (70%), Positives = 32/34 (94%)
 Frame = +1

Query: 253 QITITNDKGRLSKEEIERMVNEAEKYRNEDDKAK 354
           +ITITNDKGRLSK++IE+MV EAEKY++ED++ K
Sbjct: 506 KITITNDKGRLSKDDIEKMVQEAEKYKSEDEEHK 539


>At5g42020.1 68418.m05115 luminal binding protein 2 (BiP-2) (BP2)
           similar to SWISS-PROT: Q39043; GI:1303695; luminal
           binding protein (BiP) [Arabidopsis thaliana]
          Length = 668

 Score =  107 bits (258), Expect = 4e-24
 Identities = 54/133 (40%), Positives = 78/133 (58%)
 Frame = +2

Query: 47  YSDNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSA 226
           Y D Q  V IQVFEGER++TKD  LLGKF+LTG+PPAPRG PQIEVTF++DANGILNV A
Sbjct: 462 YQDQQTTVSIQVFEGERSLTKDCRLLGKFDLTGVPPAPRGTPQIEVTFEVDANGILNVKA 521

Query: 227 IEKSTNKENRSPLPTTKVVSPRKRSSVWLMRQRSTETRMTRQKETIQGQECIGILLASA* 406
            +K++ K  +  +   K    ++     +           + KE I  +  +   + +  
Sbjct: 522 EDKASGKSEKITITNEKGRLSQEEIDRMVKEAEEFAEEDKKVKEKIDARNALETYVYNMK 581

Query: 407 SATMEDEKLKEKI 445
           +   + +KL +K+
Sbjct: 582 NQVSDKDKLADKL 594


>At5g28540.1 68418.m03480 luminal binding protein 1 (BiP-1) (BP1)
           SWISS-PROT:Q9LKR3 PMID:8888624
          Length = 669

 Score =  105 bits (253), Expect = 2e-23
 Identities = 54/133 (40%), Positives = 77/133 (57%)
 Frame = +2

Query: 47  YSDNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSA 226
           Y D Q  V IQVFEGER++TKD  LLGKF+L GIPPAPRG PQIEVTF++DANGILNV A
Sbjct: 462 YQDQQTTVSIQVFEGERSLTKDCRLLGKFDLNGIPPAPRGTPQIEVTFEVDANGILNVKA 521

Query: 227 IEKSTNKENRSPLPTTKVVSPRKRSSVWLMRQRSTETRMTRQKETIQGQECIGILLASA* 406
            +K++ K  +  +   K    ++     +           + KE I  +  +   + +  
Sbjct: 522 EDKASGKSEKITITNEKGRLSQEEIDRMVKEAEEFAEEDKKVKEKIDARNALETYVYNMK 581

Query: 407 SATMEDEKLKEKI 445
           +   + +KL +K+
Sbjct: 582 NQVNDKDKLADKL 594


>At1g09080.1 68414.m01013 luminal binding protein 3 (BiP-3) (BP3)
           Similar to Arabidopsis luminal binding protein
           (gb|D89342); contains Pfam domain PF00012: dnaK protein
          Length = 678

 Score = 99.1 bits (236), Expect = 2e-21
 Identities = 57/140 (40%), Positives = 74/140 (52%)
 Frame = +2

Query: 47  YSDNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSA 226
           Y D Q  V I V+EGER+MTKDN  LGKF+LTGI PAPRGVPQIEVTF++DANGIL V A
Sbjct: 476 YQDQQTTVTINVYEGERSMTKDNRELGKFDLTGILPAPRGVPQIEVTFEVDANGILQVKA 535

Query: 227 IEKSTNKENRSPLPTTKVVSPRKRSSVWLMRQRSTETRMTRQKETIQGQECIGILLASA* 406
            +K         +   K     +     +             KE I  +  +   + +  
Sbjct: 536 EDKVAKTSQSITITNDKGRLTEEEIEEMIREAEEFAEEDKIMKEKIDARNKLETYVYNMK 595

Query: 407 SATMEDEKLKEKILLNSDKQ 466
           S   + EKL +KI  + DK+
Sbjct: 596 STVADKEKLAKKI-SDEDKE 614


>At5g09590.1 68418.m01110 heat shock protein 70 / HSP70 (HSC70-5)
           identical to heat shock protein 70 [Arabidopsis
           thaliana] GI:6746590
          Length = 682

 Score = 97.1 bits (231), Expect = 8e-21
 Identities = 45/66 (68%), Positives = 54/66 (81%)
 Frame = +2

Query: 50  SDNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSAI 229
           +DNQ  V I+V +GER M  DN LLG+F+L GIPP+PRGVPQIEVTFDIDANGI+ VSA 
Sbjct: 479 ADNQTQVGIRVLQGEREMATDNKLLGEFDLVGIPPSPRGVPQIEVTFDIDANGIVTVSAK 538

Query: 230 EKSTNK 247
           +K+T K
Sbjct: 539 DKTTGK 544


>At4g37910.1 68417.m05361 heat shock protein 70, mitochondrial,
           putative / HSP70, mitochondrial, putative strong
           similarity to SP|Q01899 Heat shock 70 kDa protein,
           mitochondrial precursor {Phaseolus vulgaris}
          Length = 682

 Score = 96.7 bits (230), Expect = 1e-20
 Identities = 45/67 (67%), Positives = 54/67 (80%)
 Frame = +2

Query: 50  SDNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSAI 229
           +DNQ  V I+V +GER M  DN +LG+F+L GIPPAPRG+PQIEVTFDIDANGI  VSA 
Sbjct: 474 ADNQMQVGIKVLQGEREMAADNKVLGEFDLVGIPPAPRGMPQIEVTFDIDANGITTVSAK 533

Query: 230 EKSTNKE 250
           +K+T KE
Sbjct: 534 DKATGKE 540



 Score = 28.7 bits (61), Expect = 3.2
 Identities = 16/35 (45%), Positives = 21/35 (60%)
 Frame = +1

Query: 250 EQITITNDKGRLSKEEIERMVNEAEKYRNEDDKAK 354
           + ITI +  G LS +EI RMV EAE    +D + K
Sbjct: 541 QNITIRSSGG-LSDDEINRMVKEAELNAQKDQEKK 574


>At4g24280.1 68417.m03486 heat shock protein 70, putative / HSP70,
           putative strong similarity to heat shock protein 70
           [Arabidopsis thaliana] GI:6746592; similar to heat shock
           70 protein - Spinacia oleracea,PID:g2654208
          Length = 718

 Score = 93.5 bits (222), Expect = 1e-19
 Identities = 43/67 (64%), Positives = 50/67 (74%)
 Frame = +2

Query: 50  SDNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSAI 229
           +D Q  V I V +GER   +DN  LG F L GIPPAPRGVPQIEV FDIDANGIL+VSA+
Sbjct: 501 ADGQTSVEINVLQGEREFVRDNKSLGSFRLDGIPPAPRGVPQIEVKFDIDANGILSVSAV 560

Query: 230 EKSTNKE 250
           +K T K+
Sbjct: 561 DKGTGKK 567



 Score = 32.3 bits (70), Expect = 0.26
 Identities = 17/37 (45%), Positives = 25/37 (67%)
 Frame = +1

Query: 250 EQITITNDKGRLSKEEIERMVNEAEKYRNEDDKAKGD 360
           + ITIT     L K+E+++MV EAE++  +DDK K D
Sbjct: 568 QDITITG-ASTLPKDEVDQMVQEAERFA-KDDKEKRD 602


>At5g49910.1 68418.m06180 heat shock protein 70 / HSP70 (HSC70-7)
           identical to heat shock protein 70 [Arabidopsis
           thaliana] GI:6746592
          Length = 718

 Score = 90.6 bits (215), Expect = 7e-19
 Identities = 42/67 (62%), Positives = 49/67 (73%)
 Frame = +2

Query: 50  SDNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSAI 229
           +D Q  V I V +GER   +DN  +G F L GIPPAPRGVPQIEV FDIDANGIL+VSA 
Sbjct: 501 ADGQTSVEINVLQGEREFVRDNKSIGSFRLDGIPPAPRGVPQIEVKFDIDANGILSVSAS 560

Query: 230 EKSTNKE 250
           +K T K+
Sbjct: 561 DKGTGKK 567



 Score = 30.7 bits (66), Expect = 0.80
 Identities = 17/37 (45%), Positives = 23/37 (62%)
 Frame = +1

Query: 250 EQITITNDKGRLSKEEIERMVNEAEKYRNEDDKAKGD 360
           + ITIT     L K+E++ MV EAE++  E DK K D
Sbjct: 568 QDITITG-ASTLPKDEVDTMVQEAERFAKE-DKEKRD 602


>At5g42020.2 68418.m05116 luminal binding protein 2 (BiP-2) (BP2)
           similar to SWISS-PROT: Q39043; GI:1303695; luminal
           binding protein (BiP) [Arabidopsis thaliana]
          Length = 613

 Score = 84.2 bits (199), Expect = 6e-17
 Identities = 46/104 (44%), Positives = 59/104 (56%), Gaps = 8/104 (7%)
 Frame = +2

Query: 47  YSDNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFD-IDANGILNVS 223
           Y D Q  V IQVFEGER++TKD  LLGKF+LTG+PPAPRG PQIEVTF+ IDA   L   
Sbjct: 462 YQDQQTTVSIQVFEGERSLTKDCRLLGKFDLTGVPPAPRGTPQIEVTFEKIDARNALETY 521

Query: 224 AIEKSTNKENRSPL-------PTTKVVSPRKRSSVWLMRQRSTE 334
                    ++  L          K+ +  K +  WL   +++E
Sbjct: 522 VYNMKNQVSDKDKLADKLEGDEKEKIEAATKEALEWLDENQNSE 565


>At2g32120.2 68415.m03926 heat shock protein 70 family protein /
           HSP70 family protein similar to SP|P22953 Heat shock
           cognate 70 kDa protein 1 (Hsc70.1) {Arabidopsis
           thaliana}; contains InterPro accession IPR001023: Heat
           shock protein Hsp70
          Length = 563

 Score = 69.7 bits (163), Expect = 1e-12
 Identities = 32/58 (55%), Positives = 41/58 (70%)
 Frame = +2

Query: 53  DNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSA 226
           DNQ   LI ++EGE    ++N+LLG F+L GIPPAP+GVP+I V  DIDA+  L V A
Sbjct: 456 DNQKEALIIIYEGEGETVEENHLLGYFKLVGIPPAPKGVPEINVCMDIDASNALRVFA 513


>At2g32120.1 68415.m03925 heat shock protein 70 family protein /
           HSP70 family protein similar to SP|P22953 Heat shock
           cognate 70 kDa protein 1 (Hsc70.1) {Arabidopsis
           thaliana}; contains InterPro accession IPR001023: Heat
           shock protein Hsp70
          Length = 563

 Score = 69.7 bits (163), Expect = 1e-12
 Identities = 32/58 (55%), Positives = 41/58 (70%)
 Frame = +2

Query: 53  DNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSA 226
           DNQ   LI ++EGE    ++N+LLG F+L GIPPAP+GVP+I V  DIDA+  L V A
Sbjct: 456 DNQKEALIIIYEGEGETVEENHLLGYFKLVGIPPAPKGVPEINVCMDIDASNALRVFA 513


>At5g09400.1 68418.m01089 potassium transporter family protein
           similar to K+ transporter HAK5 [Arabidopsis thaliana]
           GI:7108597; contains Pfam profile PF02705: K+ potassium
           transporter; KUP/HAK/KT Transporter family member,
           PMID:11500563; Note: possible sequencing error causes a
           frameshift in the 4th exon|15810448|gb|AY056263
          Length = 858

 Score = 31.9 bits (69), Expect = 0.34
 Identities = 30/107 (28%), Positives = 50/107 (46%), Gaps = 1/107 (0%)
 Frame = +1

Query: 184 HLRHRCQRYPQRFRYREVHQQGEQITITNDKGRLSKEEIERMVNEAEKYRNEDDKAKGDH 363
           HL     RY  +   +E HQ  EQ+ I + +  + +E  ER +   E   N+D  ++ D 
Sbjct: 669 HLFRCIARYGYKDARKETHQAFEQLLIESLEKFIRREAQERSL---ESDGNDDSDSEEDF 725

Query: 364 PGPRMHWNLTGFSMKCYHGG*EAQGKD-SPEL*QADHSSNKCNIHPF 501
           PG R+     G SM        ++ +D +  + + + SS+  N HPF
Sbjct: 726 PGSRVVIGPNG-SMYSMGVPLLSEYRDLNKPIMEMNTSSDHTNHHPF 771


>At5g55670.1 68418.m06941 RNA recognition motif (RRM)-containing
           protein 
          Length = 710

 Score = 31.1 bits (67), Expect = 0.60
 Identities = 19/66 (28%), Positives = 28/66 (42%)
 Frame = +1

Query: 190 RHRCQRYPQRFRYREVHQQGEQITITNDKGRLSKEEIERMVNEAEKYRNEDDKAKGDHPG 369
           RHR  R   R R RE H +  + +  + + R  + E +R   E E+Y  +      D P 
Sbjct: 608 RHRDDRDTGREREREHHHKDRERSREHVRDRERERERDRHREERERYGGDHRTRHRDEPE 667

Query: 370 PRMHWN 387
               WN
Sbjct: 668 HDEEWN 673


>At1g33770.1 68414.m04174 protein kinase family protein contains
           Pfam domain, PF00069: Protein kinase domain
          Length = 614

 Score = 29.1 bits (62), Expect = 2.4
 Identities = 19/49 (38%), Positives = 25/49 (51%)
 Frame = +2

Query: 161 RGVPQIEVTFDIDANGILNVSAIEKSTNKENRSPLPTTKVVSPRKRSSV 307
           RG+   +VT +  A+G  NVS    S  KE R    T  V+ P  RS+V
Sbjct: 473 RGLRDSKVTPEFIASGNSNVSLTTPSFKKEKRF-TDTNSVIHPSSRSNV 520


>At1g29000.1 68414.m03546 heavy-metal-associated domain-containing
           protein similar to farnesylated protein ATFP3
           [GI:4097547]; contains Pfam profile PF00403:
           Heavy-metal-associated domain
          Length = 287

 Score = 29.1 bits (62), Expect = 2.4
 Identities = 12/42 (28%), Positives = 25/42 (59%)
 Frame = +1

Query: 229 REVHQQGEQITITNDKGRLSKEEIERMVNEAEKYRNEDDKAK 354
           ++VH+  E I+   ++ +  +EE ++   E +K + ED+K K
Sbjct: 169 KKVHKHAEIISSKTEEEKKKEEEDKKKKEEEDKKKKEDEKKK 210


>At2g18540.1 68415.m02160 cupin family protein contains Pfam profile
           PF00190: Cupin
          Length = 707

 Score = 28.7 bits (61), Expect = 3.2
 Identities = 15/51 (29%), Positives = 30/51 (58%)
 Frame = +1

Query: 202 QRYPQRFRYREVHQQGEQITITNDKGRLSKEEIERMVNEAEKYRNEDDKAK 354
           +R  +R R  E+ ++ EQ     ++ R  +EE+ER + E ++ + E++ AK
Sbjct: 564 KREEERKREEEMAKRREQ-----ERQRKEREEVERKIREEQERKREEEMAK 609


>At3g15560.1 68416.m01972 expressed protein
          Length = 471

 Score = 28.3 bits (60), Expect = 4.2
 Identities = 16/56 (28%), Positives = 29/56 (51%)
 Frame = +1

Query: 187 LRHRCQRYPQRFRYREVHQQGEQITITNDKGRLSKEEIERMVNEAEKYRNEDDKAK 354
           LRHR +    R   +++  +   +T  N++ RL+ +E+E   NE  K R   +K +
Sbjct: 29  LRHREEAQNMRAEMKKLDDETNDLTRKNNEDRLTIQELE---NELVKRRRRAEKCR 81


>At2g42010.1 68415.m05197 phospholipase D beta 1 / PLD beta 1
           (PLDBETA1) identical to SP|P93733 Phospholipase D beta 1
           (EC 3.1.4.4) (AtPLDbeta1) (PLD beta 1) (PLDbeta)
           {Arabidopsis thaliana}; contains Pfam profiles: PF00614
           phospholipase D.active site motif, PF00168 C2 domain
          Length = 1083

 Score = 28.3 bits (60), Expect = 4.2
 Identities = 12/31 (38%), Positives = 19/31 (61%)
 Frame = -3

Query: 153 GGIPVSSNLPSKLLSLVIARSPSNTWMSTPG 61
           GG+ +S+N P   +   ++  PSN+W S PG
Sbjct: 187 GGLHISTNQPGPSVPQ-LSSLPSNSWQSRPG 216


>At2g12900.1 68415.m01408 hypothetical protein similar to
           transcription factor(bZIP family) VSF-1 GI:3425907 from
           [Lycopersicon esculentum]
          Length = 264

 Score = 28.3 bits (60), Expect = 4.2
 Identities = 13/41 (31%), Positives = 22/41 (53%)
 Frame = +1

Query: 256 ITITNDKGRLSKEEIERMVNEAEKYRNEDDKAKGDHPGPRM 378
           ITI+N+KG +  + ++    E  +YR E D++      P M
Sbjct: 210 ITISNEKGSVELQRLKMETCEVLQYRREFDRSNMQGMDPNM 250


>At3g55150.1 68416.m06125 exocyst subunit EXO70 family protein
           contains Pfam domain PF03081: Exo70 exocyst complex
           subunit; tomato leucine zipper-containing protein,
           Lycopersicon esculentum, PIR:S21495
          Length = 636

 Score = 27.5 bits (58), Expect = 7.4
 Identities = 10/20 (50%), Positives = 13/20 (65%)
 Frame = -2

Query: 157 RRWDPGQLEFTEQVVIFGHS 98
           R+WDP    FT+ V +F HS
Sbjct: 54  RKWDPNTPSFTKIVSLFNHS 73


>At2g43970.2 68415.m05468 La domain-containing protein contains Pfam
           profile PF05383: La domain
          Length = 529

 Score = 27.5 bits (58), Expect = 7.4
 Identities = 13/44 (29%), Positives = 27/44 (61%)
 Frame = +1

Query: 232 EVHQQGEQITITNDKGRLSKEEIERMVNEAEKYRNEDDKAKGDH 363
           +V + G  ++I +  G L ++ I+++VN+ E Y ++ + A  DH
Sbjct: 173 QVTETGASVSIDSKTG-LPEDSIQKIVNQVEYYFSDLNLATTDH 215


>At2g43970.1 68415.m05467 La domain-containing protein contains Pfam
           profile PF05383: La domain
          Length = 545

 Score = 27.5 bits (58), Expect = 7.4
 Identities = 13/44 (29%), Positives = 27/44 (61%)
 Frame = +1

Query: 232 EVHQQGEQITITNDKGRLSKEEIERMVNEAEKYRNEDDKAKGDH 363
           +V + G  ++I +  G L ++ I+++VN+ E Y ++ + A  DH
Sbjct: 173 QVTETGASVSIDSKTG-LPEDSIQKIVNQVEYYFSDLNLATTDH 215


>At5g62310.1 68418.m07822 incomplete root hair elongation (IRE) /
           protein kinase, putative nearly identical to IRE
           (incomplete root hair elongation) [Arabidopsis thaliana]
           gi|6729346|dbj|BAA89783
          Length = 1168

 Score = 27.1 bits (57), Expect = 9.8
 Identities = 15/64 (23%), Positives = 27/64 (42%)
 Frame = +2

Query: 167 VPQIEVTFDIDANGILNVSAIEKSTNKENRSPLPTTKVVSPRKRSSVWLMRQRSTETRMT 346
           VP+ + TF +D   ILN  ++   T   +   L      +PR      L+  R T + + 
Sbjct: 579 VPRSQNTFSLDELNILNEMSMTNGTKDSSAGSLTPPSPATPRNSQVDLLLSGRKTISELE 638

Query: 347 RQKE 358
             ++
Sbjct: 639 NYQQ 642


>At4g31800.1 68417.m04517 WRKY family transcription factor
          Length = 310

 Score = 27.1 bits (57), Expect = 9.8
 Identities = 14/42 (33%), Positives = 22/42 (52%), Gaps = 2/42 (4%)
 Frame = +1

Query: 433 QGKDSPEL*QADHSSNKCNIHPFKWMGFPV--QAGRARRSMS 552
           Q + SPE+ Q D    K    P +++GFP+   +G+   S S
Sbjct: 85  QSRQSPEIEQTDIPIKKRKQDPDEFLGFPIGLSSGKTENSSS 126


>At1g73010.1 68414.m08443 expressed protein similar to phosphatase,
           orphan 1 (GI:20196841) [Mus musculus], (GI:20196839)
           [Homo sapiens]; contains TIGRFAM TIGR01489:
           2,3-diketo-5-methylthio-1-phosphopentane phosphatase
           profile; contains TIGRFAM TIGR01488: HAD-superfamily
           hydrolase, subfamily IB (PSPase-like)
          Length = 295

 Score = 27.1 bits (57), Expect = 9.8
 Identities = 19/66 (28%), Positives = 31/66 (46%)
 Frame = +2

Query: 263 LPTTKVVSPRKRSSVWLMRQRSTETRMTRQKETIQGQECIGILLASA*SATMEDEKLKEK 442
           L T   V PRK   VW +  ++        +E   GQ    IL+ +     +E+E  KEK
Sbjct: 201 LNTEDYVMPRKNFPVWDLISQNPMLIKAAIREWTDGQSMEMILIGTIEEIRLEEE--KEK 258

Query: 443 ILLNSD 460
           +L +++
Sbjct: 259 MLTSAE 264


>At1g55600.1 68414.m06364 WRKY family transcription factor similar
           to SPF1 protein GI:484261 from [Ipomoea batatas];
           contains Pfam profile: PF03106 WRKY DNA -binding domain
          Length = 485

 Score = 27.1 bits (57), Expect = 9.8
 Identities = 16/66 (24%), Positives = 26/66 (39%)
 Frame = +1

Query: 211 PQRFRYREVHQQGEQITITNDKGRLSKEEIERMVNEAEKYRNEDDKAKGDHPGPRMHWNL 390
           P+R RY   +  G   T    +  L  E  E   N+  ++R    K    +P PR ++  
Sbjct: 273 PKRRRYEVSNMIGATRTSKTQRIILQMESDEDNPNDGYRWRKYGQKVVKGNPNPRSYFKC 332

Query: 391 TGFSMK 408
           T    +
Sbjct: 333 TNIECR 338


>At1g01350.1 68414.m00050 zinc finger (CCCH-type/C3HC4-type RING
           finger) family protein similar to SP|O15541 Zinc finger
           protein 183 {Homo sapiens}; contains Pfam profiles
           PF04396: Protein of unknown function, DUF537, PF00097:
           Zinc finger, C3HC4 type (RING finger), PF00642: Zinc
           finger C-x8-C-x5-C-x3-H type (and similar)
          Length = 586

 Score = 27.1 bits (57), Expect = 9.8
 Identities = 10/20 (50%), Positives = 14/20 (70%)
 Frame = +1

Query: 301 ERMVNEAEKYRNEDDKAKGD 360
           E   +E++ YRNEDD+  GD
Sbjct: 555 EEHAHESQYYRNEDDETDGD 574


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 14,407,970
Number of Sequences: 28952
Number of extensions: 314956
Number of successful extensions: 1224
Number of sequences better than 10.0: 32
Number of HSP's better than 10.0 without gapping: 1161
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1213
length of database: 12,070,560
effective HSP length: 78
effective length of database: 9,812,304
effective search space used: 1226538000
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).