SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS30012
         (706 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At1g23230.1 68414.m02906 expressed protein                             34   0.080
At5g28120.1 68418.m03396 hypothetical protein                          30   1.3  
At3g30816.1 68416.m03949 hypothetical protein                          30   1.7  
At2g06860.1 68415.m00768 Ulp1 protease family protein contains P...    30   1.7  
At4g36890.1 68417.m05230 glycosyl transferase family 43 protein ...    29   2.3  
At1g62440.1 68414.m07044 leucine-rich repeat family protein / ex...    29   3.0  
At4g05300.1 68417.m00803 hypothetical protein                          29   4.0  
At3g07195.1 68416.m00858 proline-rich family protein                   29   4.0  
At1g21310.1 68414.m02662 proline-rich extensin-like family prote...    29   4.0  
At2g29580.1 68415.m03592 zinc finger (CCCH-type) family protein ...    28   5.2  
At1g51830.1 68414.m05843 leucine-rich repeat protein kinase, put...    28   5.2  
At1g31310.1 68414.m03831 hydroxyproline-rich glycoprotein family...    28   5.2  
At5g28110.1 68418.m03395 hypothetical protein                          28   6.9  
At4g21900.1 68417.m03166 MATE efflux family protein similar to r...    28   6.9  
At4g19190.1 68417.m02832 zinc knuckle (CCHC-type) family protein...    28   6.9  
At3g56140.1 68416.m06240 expressed protein At2g40400 - Arabidops...    28   6.9  
At5g39080.1 68418.m04728 transferase family protein similar to a...    27   9.2  
At5g05320.1 68418.m00573 monooxygenase, putative (MO3) similar t...    27   9.2  
At1g15000.1 68414.m01792 serine carboxypeptidase S10 family prot...    27   9.2  

>At1g23230.1 68414.m02906 expressed protein
          Length = 1615

 Score = 34.3 bits (75), Expect = 0.080
 Identities = 19/51 (37%), Positives = 29/51 (56%)
 Frame = -3

Query: 464 YVNIDVFLYKRSTRVSTRISATESSITSEAQTAAAAKGESTTETESIRRVS 312
           Y+N D FL      + + +SA E+S++   Q AAA  G S T ++S+  VS
Sbjct: 126 YINWDTFL----PSLLSSVSAAEASLSQGVQAAAATAGSSATSSQSVVPVS 172


>At5g28120.1 68418.m03396 hypothetical protein
          Length = 506

 Score = 30.3 bits (65), Expect = 1.3
 Identities = 19/51 (37%), Positives = 28/51 (54%)
 Frame = -3

Query: 437 KRSTRVSTRISATESSITSEAQTAAAAKGESTTETESIRRVSAAKGNAASR 285
           ++S R STRISA+E +  S        KGES T+    RR++  K +  +R
Sbjct: 342 EKSVRGSTRISASEHTQGSPIDAILPIKGES-TKNGVTRRITNGKVHGGNR 391


>At3g30816.1 68416.m03949 hypothetical protein
          Length = 342

 Score = 29.9 bits (64), Expect = 1.7
 Identities = 20/54 (37%), Positives = 27/54 (50%), Gaps = 2/54 (3%)
 Frame = -3

Query: 437 KRSTRVSTRISATESSITSEAQTAAAAKGESTTE--TESIRRVSAAKGNAASRK 282
           K+S R STRISA+E +  S        KGEST    T  I      +GN  +++
Sbjct: 179 KKSVRGSTRISASEHTQGSPMDAILPIKGESTKNGVTRWITNGKVHRGNRWTKR 232


>At2g06860.1 68415.m00768 Ulp1 protease family protein contains Pfam
            profile PF02902: Ulp1 protease family, C-terminal
            catalytic domain
          Length = 938

 Score = 29.9 bits (64), Expect = 1.7
 Identities = 20/53 (37%), Positives = 27/53 (50%), Gaps = 2/53 (3%)
 Frame = -3

Query: 434  RSTRVSTRISATESSITSEAQTAAAAKGESTT--ETESIRRVSAAKGNAASRK 282
            +S R STRISA+E +  S        KGEST     E+ RR    KG++   +
Sbjct: 843  KSVRGSTRISASEHTQGSPMDAILPVKGESTKNGHGETDRRSVRPKGDSTDNQ 895


>At4g36890.1 68417.m05230 glycosyl transferase family 43 protein low
           similarity to Galactosylgalactosylxylosylprotein
           3-beta-glucuronosyltransferase 1, Homo sapiens
           [SP|Q9P2W7], Rattus norvegicus [SP|O35789]; contains
           Pfam domain Glycosyltransferase family 43 [PF03360]
          Length = 525

 Score = 29.5 bits (63), Expect = 2.3
 Identities = 12/43 (27%), Positives = 20/43 (46%)
 Frame = +2

Query: 131 PVWLWPMAALNLQWDTATPLPEVTQEASALPLSAADTELLLWW 259
           P W+    +LN      +PL  +   +   PL +   ++LLWW
Sbjct: 381 PEWVKDFGSLNENEGVESPLSLLKDPSMVEPLGSCGRQVLLWW 423


>At1g62440.1 68414.m07044 leucine-rich repeat family protein /
           extensin family protein similar to extensin-like protein
           [Lycopersicon esculentum] gi|5917664|gb|AAD55979;
           contains leucine-rich repeats, Pfam:PF00560; contains
           proline rich extensin domains, INTERPRO:IPR002965
          Length = 826

 Score = 29.1 bits (62), Expect = 3.0
 Identities = 18/45 (40%), Positives = 21/45 (46%)
 Frame = +3

Query: 465 PPPEPVEQRLPRIPGVAPPQKHYKIIFIKGPNSSHSYCPHNSYPT 599
           PP  PVE   P  P  +PP + Y+    KG N S S   H   PT
Sbjct: 750 PPSTPVEYHPPASPNQSPPPE-YQSPPPKGCNDSPSNDHHYQTPT 793


>At4g05300.1 68417.m00803 hypothetical protein
          Length = 387

 Score = 28.7 bits (61), Expect = 4.0
 Identities = 19/54 (35%), Positives = 28/54 (51%), Gaps = 2/54 (3%)
 Frame = -3

Query: 437 KRSTRVSTRISATESSITSEAQTAAAAKGESTT--ETESIRRVSAAKGNAASRK 282
           ++S R STRISA+E +  S        KGEST     E+ +R    KG++   +
Sbjct: 301 EKSVRGSTRISASEHTQGSPMDAILPVKGESTKNGHGETDQRSVRPKGDSTDNQ 354


>At3g07195.1 68416.m00858 proline-rich family protein
          Length = 225

 Score = 28.7 bits (61), Expect = 4.0
 Identities = 10/28 (35%), Positives = 17/28 (60%)
 Frame = +2

Query: 596 NHKTKRRHSVYVLVKKPEEQPDIIIPTP 679
           N +T +R  +Y  ++KPE +P  + P P
Sbjct: 26  NARTNKRQDLYESIEKPETKPQELAPPP 53


>At1g21310.1 68414.m02662 proline-rich extensin-like family protein
           contains extensin-like region, Pfam:PF04554
          Length = 431

 Score = 28.7 bits (61), Expect = 4.0
 Identities = 19/56 (33%), Positives = 26/56 (46%), Gaps = 2/56 (3%)
 Frame = +3

Query: 432 PLVQKHIYVHVPPPEPVEQRLPRIPGVAPPQKHYKIIFIKGPNSS-HSYC-PHNSY 593
           P  +KH YV+  PP PV+   P     +PP    K ++   P    H Y  PH+ Y
Sbjct: 366 PPPKKH-YVYKSPPPPVKHYSPPPVYHSPPPPKEKYVYKSPPPPPVHHYSPPHHPY 420



 Score = 27.9 bits (59), Expect = 6.9
 Identities = 19/56 (33%), Positives = 25/56 (44%), Gaps = 2/56 (3%)
 Frame = +3

Query: 432 PLVQKHIYVHVPPPEPVEQRLPR--IPGVAPPQKHYKIIFIKGPNSSHSYCPHNSY 593
           P  +KH YV+  PP PV+   P        PP+KHY  ++   P     Y P   Y
Sbjct: 86  PPPKKH-YVYKSPPPPVKHYSPPPVYHSPPPPKKHY--VYKSPPPPVKHYSPPPVY 138



 Score = 27.9 bits (59), Expect = 6.9
 Identities = 19/56 (33%), Positives = 25/56 (44%), Gaps = 2/56 (3%)
 Frame = +3

Query: 432 PLVQKHIYVHVPPPEPVEQRLPR--IPGVAPPQKHYKIIFIKGPNSSHSYCPHNSY 593
           P  +KH YV+  PP PV+   P        PP+KHY  ++   P     Y P   Y
Sbjct: 114 PPPKKH-YVYKSPPPPVKHYSPPPVYHSPPPPKKHY--VYKSPPPPVKHYSPPPVY 166



 Score = 27.9 bits (59), Expect = 6.9
 Identities = 19/56 (33%), Positives = 25/56 (44%), Gaps = 2/56 (3%)
 Frame = +3

Query: 432 PLVQKHIYVHVPPPEPVEQRLPR--IPGVAPPQKHYKIIFIKGPNSSHSYCPHNSY 593
           P  +KH YV+  PP PV+   P        PP+KHY  ++   P     Y P   Y
Sbjct: 142 PPPKKH-YVYKSPPPPVKHYSPPPVYHSPPPPKKHY--VYKSPPPPVKHYSPPPVY 194



 Score = 27.9 bits (59), Expect = 6.9
 Identities = 19/56 (33%), Positives = 25/56 (44%), Gaps = 2/56 (3%)
 Frame = +3

Query: 432 PLVQKHIYVHVPPPEPVEQRLPR--IPGVAPPQKHYKIIFIKGPNSSHSYCPHNSY 593
           P  +KH YV+  PP PV+   P        PP+KHY  ++   P     Y P   Y
Sbjct: 170 PPPKKH-YVYKSPPPPVKHYSPPPVYHSPPPPKKHY--VYKSPPPPVKHYSPPPVY 222



 Score = 27.9 bits (59), Expect = 6.9
 Identities = 19/56 (33%), Positives = 25/56 (44%), Gaps = 2/56 (3%)
 Frame = +3

Query: 432 PLVQKHIYVHVPPPEPVEQRLPR--IPGVAPPQKHYKIIFIKGPNSSHSYCPHNSY 593
           P  +KH YV+  PP PV+   P        PP+KHY  ++   P     Y P   Y
Sbjct: 198 PPPKKH-YVYKSPPPPVKHYSPPPVYHSPPPPKKHY--VYKSPPPPVKHYSPPPVY 250



 Score = 27.9 bits (59), Expect = 6.9
 Identities = 19/56 (33%), Positives = 25/56 (44%), Gaps = 2/56 (3%)
 Frame = +3

Query: 432 PLVQKHIYVHVPPPEPVEQRLPR--IPGVAPPQKHYKIIFIKGPNSSHSYCPHNSY 593
           P  +KH YV+  PP PV+   P        PP+KHY  ++   P     Y P   Y
Sbjct: 226 PPPKKH-YVYKSPPPPVKHYSPPPVYHSPPPPKKHY--VYKSPPPPVKHYSPPPVY 278



 Score = 27.9 bits (59), Expect = 6.9
 Identities = 19/56 (33%), Positives = 25/56 (44%), Gaps = 2/56 (3%)
 Frame = +3

Query: 432 PLVQKHIYVHVPPPEPVEQRLPR--IPGVAPPQKHYKIIFIKGPNSSHSYCPHNSY 593
           P  +KH YV+  PP PV+   P        PP+KHY  ++   P     Y P   Y
Sbjct: 254 PPPKKH-YVYKSPPPPVKHYSPPPVYHSPPPPKKHY--VYKSPPPPVKHYSPPPVY 306



 Score = 27.9 bits (59), Expect = 6.9
 Identities = 19/56 (33%), Positives = 25/56 (44%), Gaps = 2/56 (3%)
 Frame = +3

Query: 432 PLVQKHIYVHVPPPEPVEQRLPR--IPGVAPPQKHYKIIFIKGPNSSHSYCPHNSY 593
           P  +KH YV+  PP PV+   P        PP+KHY  ++   P     Y P   Y
Sbjct: 282 PPPKKH-YVYKSPPPPVKHYSPPPVYHSPPPPKKHY--VYKSPPPPVKHYSPPPVY 334



 Score = 27.9 bits (59), Expect = 6.9
 Identities = 19/56 (33%), Positives = 25/56 (44%), Gaps = 2/56 (3%)
 Frame = +3

Query: 432 PLVQKHIYVHVPPPEPVEQRLPR--IPGVAPPQKHYKIIFIKGPNSSHSYCPHNSY 593
           P  +KH YV+  PP PV+   P        PP+KHY  ++   P     Y P   Y
Sbjct: 310 PPPKKH-YVYKSPPPPVKHYSPPPVYHSPPPPKKHY--VYKSPPPPVKHYSPPPVY 362



 Score = 27.9 bits (59), Expect = 6.9
 Identities = 19/56 (33%), Positives = 25/56 (44%), Gaps = 2/56 (3%)
 Frame = +3

Query: 432 PLVQKHIYVHVPPPEPVEQRLPR--IPGVAPPQKHYKIIFIKGPNSSHSYCPHNSY 593
           P  +KH YV+  PP PV+   P        PP+KHY  ++   P     Y P   Y
Sbjct: 338 PPPKKH-YVYKSPPPPVKHYSPPPVYHSPPPPKKHY--VYKSPPPPVKHYSPPPVY 390


>At2g29580.1 68415.m03592 zinc finger (CCCH-type) family protein /
           RNA recognition motif (RRM)-containing protein similar
           to SP|O59800 Cell cycle control protein cwf5
           {Schizosaccharomyces pombe}; contains Pfam profile:
           PF00076 RNA recognition motif (aka RRM, RBD, or RNP
           domain)
          Length = 483

 Score = 28.3 bits (60), Expect = 5.2
 Identities = 12/29 (41%), Positives = 17/29 (58%)
 Frame = +3

Query: 432 PLVQKHIYVHVPPPEPVEQRLPRIPGVAP 518
           P++Q   Y+H PPP+P  Q  P  P + P
Sbjct: 337 PMLQ--YYMHPPPPQPPHQDRPFYPSMDP 363


>At1g51830.1 68414.m05843 leucine-rich repeat protein kinase,
           putative similar to light repressible receptor protein
           kinase GI:1321686 from [Arabidopsis thaliana]
          Length = 675

 Score = 28.3 bits (60), Expect = 5.2
 Identities = 18/56 (32%), Positives = 25/56 (44%), Gaps = 1/56 (1%)
 Frame = +2

Query: 137 WLWPMAALNLQWDTATPLPEVTQEASALPLSAADTELLLWWSFWIPRWPFWRQ-HF 301
           W      LN+   T   LP+     +A PL+A  T L + W+   P  PF+   HF
Sbjct: 29  WTQVTTNLNVNISTIYELPQSVMSTAATPLNANAT-LNITWTIEPPTTPFYSYIHF 83


>At1g31310.1 68414.m03831 hydroxyproline-rich glycoprotein family
           protein contains proline-rich extensin domains,
           INTERPRO:IPR002965;
          Length = 383

 Score = 28.3 bits (60), Expect = 5.2
 Identities = 18/57 (31%), Positives = 25/57 (43%), Gaps = 4/57 (7%)
 Frame = +3

Query: 465 PPPEPVEQRLPR---IPGVAPPQKHYK-IIFIKGPNSSHSYCPHNSYPTTKRREDTP 623
           PPP P  Q LPR   +P   PP  H + I+  K  ++      ++     KRR   P
Sbjct: 223 PPPPPPSQPLPRPLLLPPPPPPSFHAQPILPTKDSSTDSDTSEYSDTSPAKRRRTMP 279


>At5g28110.1 68418.m03395 hypothetical protein
          Length = 493

 Score = 27.9 bits (59), Expect = 6.9
 Identities = 18/51 (35%), Positives = 27/51 (52%)
 Frame = -3

Query: 437 KRSTRVSTRISATESSITSEAQTAAAAKGESTTETESIRRVSAAKGNAASR 285
           ++S R S RISA+E +  S        KGES T+    RR++  K +  +R
Sbjct: 342 EKSVRGSIRISASEHTQGSPIDAILPIKGES-TKNGVTRRITNGKVHGGNR 391


>At4g21900.1 68417.m03166 MATE efflux family protein similar to
           ripening regulated protein DDTFR18 [Lycopersicon
           esculentum] GI:12231296; contains Pfam profile PF01554:
           MatE
          Length = 1094

 Score = 27.9 bits (59), Expect = 6.9
 Identities = 18/49 (36%), Positives = 28/49 (57%)
 Frame = -3

Query: 422 VSTRISATESSITSEAQTAAAAKGESTTETESIRRVSAAKGNAASRKAT 276
           VS+ IS  ESS+T+ A+  AAAKG+     + ++ + A  G +  R  T
Sbjct: 576 VSSGISPNESSVTAVAR-LAAAKGDGDYAFKLVKDLVAVGGVSVPRLRT 623


>At4g19190.1 68417.m02832 zinc knuckle (CCHC-type) family protein
           contains Pfam domain, PF00098: Zinc knuckle
          Length = 595

 Score = 27.9 bits (59), Expect = 6.9
 Identities = 10/25 (40%), Positives = 16/25 (64%)
 Frame = +3

Query: 450 IYVHVPPPEPVEQRLPRIPGVAPPQ 524
           I  H  P EP++  L + PG++PP+
Sbjct: 251 IIAHTDPSEPLKWELKQKPGLSPPR 275


>At3g56140.1 68416.m06240 expressed protein At2g40400 - Arabidopsis
           thaliana, EMBL:AC007020
          Length = 745

 Score = 27.9 bits (59), Expect = 6.9
 Identities = 20/58 (34%), Positives = 31/58 (53%)
 Frame = -3

Query: 485 LNWFWGRYVNIDVFLYKRSTRVSTRISATESSITSEAQTAAAAKGESTTETESIRRVS 312
           LN ++G    ID+    RST + T+ S   S   SEA      + ++TTE ESI +++
Sbjct: 689 LNSYFGTQQWIDL---ARSTGLQTQKSIPASKEISEALEEPTVECDTTTEEESIDKLN 743


>At5g39080.1 68418.m04728 transferase family protein similar to
           anthocyanin 5-aromatic acyltransferase from Gentiana
           triflora GI:4185599, malonyl CoA:anthocyanin
           5-O-glucoside-6'''-O-malonyltransferase from Perilla
           frutescens GI:17980232, Salvia splendens GI:17980234;
           contains Pfam profile PF02458 transferase family
          Length = 463

 Score = 27.5 bits (58), Expect = 9.2
 Identities = 20/47 (42%), Positives = 25/47 (53%), Gaps = 7/47 (14%)
 Frame = +1

Query: 67  VSSKRISLVSSKH-KMRAFV-----VLACVAMAYG-RPEPPVGYSYS 186
           VSS   S  SSK  ++  FV     VL C+  A G  P  PVGY++S
Sbjct: 271 VSSSSSSTSSSKELRLSTFVIVYSYVLVCIIRARGGEPHRPVGYAFS 317


>At5g05320.1 68418.m00573 monooxygenase, putative (MO3) similar to
           GI:3426064; identical to cDNA monooxygenase 3, partial
           GI:3426065
          Length = 406

 Score = 27.5 bits (58), Expect = 9.2
 Identities = 20/47 (42%), Positives = 23/47 (48%), Gaps = 1/47 (2%)
 Frame = -3

Query: 380 EAQTAAAAKGESTTETESIRRV-SAAKGNAASRKAT*GSRMTTIATV 243
           EA  A   KGE+  E ES RR+    K  A SRK      +TT  TV
Sbjct: 319 EAMKAKNMKGETEDENESYRRIEDGLKKYAGSRKWRSIDLITTSYTV 365


>At1g15000.1 68414.m01792 serine carboxypeptidase S10 family protein
           similar to Serine carboxypeptidase precursor (SP:P32826)
           [Arabidopsis thaliana]; similar to GB:AAD42963 from
           [Matricaria chamomilla]
          Length = 444

 Score = 27.5 bits (58), Expect = 9.2
 Identities = 19/62 (30%), Positives = 25/62 (40%)
 Frame = +3

Query: 456 VHVPPPEPVEQRLPRIPGVAPPQKHYKIIFIKGPNSSHSYCPHNSYPTTKRREDTPYMCW 635
           V V  P+P     P  P  A P K   +     P SS  Y  + +   T    DTP + W
Sbjct: 18  VSVESPQP-----PLFPDEALPTKSGYLPVKPAPGSSMFYAFYEAQEPTTPLPDTPLLVW 72

Query: 636 LR 641
           L+
Sbjct: 73  LQ 74


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 11,999,598
Number of Sequences: 28952
Number of extensions: 203624
Number of successful extensions: 1110
Number of sequences better than 10.0: 19
Number of HSP's better than 10.0 without gapping: 747
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1078
length of database: 12,070,560
effective HSP length: 79
effective length of database: 9,783,352
effective search space used: 1516419560
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).