SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS30011
         (766 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At5g40490.1 68418.m04910 RNA recognition motif (RRM)-containing ...    68   8e-12
At4g36960.1 68417.m05238 RNA recognition motif (RRM)-containing ...    66   2e-11
At3g07810.2 68416.m00956 heterogeneous nuclear ribonucleoprotein...    65   4e-11
At3g07810.1 68416.m00955 heterogeneous nuclear ribonucleoprotein...    65   4e-11
At3g13224.2 68416.m01658 RNA recognition motif (RRM)-containing ...    65   6e-11
At3g13224.1 68416.m01657 RNA recognition motif (RRM)-containing ...    65   6e-11
At5g55550.3 68418.m06922 RNA recognition motif (RRM)-containing ...    62   4e-10
At5g55550.2 68418.m06921 RNA recognition motif (RRM)-containing ...    62   4e-10
At5g55550.1 68418.m06920 RNA recognition motif (RRM)-containing ...    62   4e-10
At4g26650.1 68417.m03840 RNA recognition motif (RRM)-containing ...    62   5e-10
At5g47620.2 68418.m05879 heterogeneous nuclear ribonucleoprotein...    61   9e-10
At5g47620.1 68418.m05878 heterogeneous nuclear ribonucleoprotein...    61   9e-10
At2g33410.1 68415.m04095 heterogeneous nuclear ribonucleoprotein...    60   2e-09
At1g17640.1 68414.m02183 RNA recognition motif (RRM)-containing ...    60   2e-09
At5g47620.3 68418.m05877 heterogeneous nuclear ribonucleoprotein...    59   3e-09
At1g58470.1 68414.m06651 RNA-binding protein (XF41) identical to...    56   2e-08
At4g14300.1 68417.m02203 heterogeneous nuclear ribonucleoprotein...    53   2e-07
At2g46780.1 68415.m05836 RNA recognition motif (RRM)-containing ...    53   2e-07
At1g33470.2 68414.m04143 RNA recognition motif (RRM)-containing ...    51   7e-07
At1g33470.1 68414.m04142 RNA recognition motif (RRM)-containing ...    51   7e-07
At1g22330.1 68414.m02793 RNA recognition motif (RRM)-containing ...    51   7e-07
At1g78260.2 68414.m09119 RNA recognition motif (RRM)-containing ...    50   2e-06
At1g78260.1 68414.m09120 RNA recognition motif (RRM)-containing ...    50   2e-06
At4g13850.2 68417.m02146 glycine-rich RNA-binding protein (GRP2)...    50   2e-06
At4g13850.1 68417.m02145 glycine-rich RNA-binding protein (GRP2)...    50   2e-06
At5g53720.1 68418.m06676 RNA recognition motif (RRM)-containing ...    49   3e-06
At1g20880.1 68414.m02615 RNA recognition motif (RRM)-containing ...    49   3e-06
At5g53680.1 68418.m06668 RNA recognition motif (RRM)-containing ...    49   4e-06
At3g26420.1 68416.m03295 glycine-rich RNA-binding protein simila...    48   9e-06
At1g76460.1 68414.m08893 RNA recognition motif (RRM)-containing ...    47   1e-05
At4g24770.1 68417.m03546 31 kDa ribonucleoprotein, chloroplast, ...    47   2e-05
At5g61030.1 68418.m07659 RNA-binding protein, putative similar t...    46   4e-05
At3g23830.2 68416.m02996 glycine-rich RNA-binding protein, putat...    46   4e-05
At3g23830.1 68416.m02995 glycine-rich RNA-binding protein, putat...    46   4e-05
At5g50250.1 68418.m06223 31 kDa ribonucleoprotein, chloroplast, ...    45   5e-05
At4g13860.1 68417.m02147 glycine-rich RNA-binding protein, putat...    45   5e-05
At1g74230.1 68414.m08597 glycine-rich RNA-binding protein simila...    45   6e-05
At1g18630.1 68414.m02322 glycine-rich RNA-binding protein, putat...    45   6e-05
At4g39260.4 68417.m05560 glycine-rich RNA-binding protein 8 (GRP...    44   8e-05
At4g39260.3 68417.m05559 glycine-rich RNA-binding protein 8 (GRP...    44   8e-05
At4g39260.2 68417.m05558 glycine-rich RNA-binding protein 8 (GRP...    44   8e-05
At4g39260.1 68417.m05557 glycine-rich RNA-binding protein 8 (GRP...    44   8e-05
At2g37510.1 68415.m04600 RNA-binding protein, putative similar t...    44   8e-05
At2g21660.2 68415.m02578 glycine-rich RNA-binding protein (GRP7)...    44   8e-05
At2g21660.1 68415.m02577 glycine-rich RNA-binding protein (GRP7)...    44   8e-05
At2g21690.1 68415.m02580 RNA-binding protein, putative similar t...    44   1e-04
At5g47320.1 68418.m05833 30S ribosomal protein S19, mitochondria...    44   1e-04
At3g06970.1 68416.m00828 RNA recognition motif (RRM)-containing ...    44   1e-04
At3g15010.2 68416.m01899 RNA recognition motif (RRM)-containing ...    43   2e-04
At3g15010.1 68416.m01898 RNA recognition motif (RRM)-containing ...    43   2e-04
At1g22910.3 68414.m02863 RNA recognition motif (RRM)-containing ...    43   2e-04
At1g22910.2 68414.m02861 RNA recognition motif (RRM)-containing ...    43   2e-04
At1g22910.1 68414.m02862 RNA recognition motif (RRM)-containing ...    43   2e-04
At5g04280.1 68418.m00421 glycine-rich RNA-binding protein              43   3e-04
At1g71800.1 68414.m08298 cleavage stimulation factor, putative s...    43   3e-04
At3g08000.1 68416.m00977 RNA-binding protein, putative similar t...    42   3e-04
At2g36660.1 68415.m04496 polyadenylate-binding protein, putative...    42   3e-04
At3g46020.1 68416.m04979 RNA-binding protein, putative similar t...    42   4e-04
At3g54770.1 68416.m06060 RNA recognition motif (RRM)-containing ...    42   6e-04
At2g37220.1 68415.m04566 29 kDa ribonucleoprotein, chloroplast, ...    42   6e-04
At5g04600.1 68418.m00460 RNA recognition motif (RRM)-containing ...    41   0.001
At4g16280.3 68417.m02471 flowering time control protein / FCA ga...    40   0.001
At4g16280.2 68417.m02470 flowering time control protein / FCA ga...    40   0.001
At3g53460.2 68416.m05901 29 kDa ribonucleoprotein, chloroplast /...    40   0.001
At3g53460.1 68416.m05900 29 kDa ribonucleoprotein, chloroplast /...    40   0.001
At3g47120.1 68416.m05116 RNA recognition motif (RRM)-containing ...    40   0.001
At2g22100.1 68415.m02625 RNA recognition motif (RRM)-containing ...    40   0.001
At1g48920.1 68414.m05480 nucleolin, putative similar to nuM1 pro...    40   0.001
At1g47490.2 68414.m05269 RNA-binding protein 47 (RBP47), putativ...    40   0.001
At1g47490.1 68414.m05270 RNA-binding protein 47 (RBP47), putativ...    40   0.001
At2g23350.1 68415.m02788 polyadenylate-binding protein, putative...    40   0.002
At1g47500.1 68414.m05272 RNA-binding protein 47 (RBP47), putativ...    40   0.002
At1g01080.1 68414.m00010 33 kDa ribonucleoprotein, chloroplast, ...    40   0.002
At3g18610.1 68416.m02365 nucleolin, putative contains Pfam profi...    40   0.002
At5g19350.1 68418.m02306 RNA-binding protein 45 (RBP45), putative      39   0.003
At5g06210.1 68418.m00693 RNA-binding protein, putative contains ...    39   0.003
At4g20030.1 68417.m02932 RNA recognition motif (RRM)-containing ...    39   0.003
At2g19380.1 68415.m02260 RNA recognition motif (RRM)-containing ...    39   0.003
At2g16260.1 68415.m01862 glycine-rich RNA-binding protein, putat...    39   0.003
At5g51300.2 68418.m06360 splicing factor-related contains simila...    39   0.004
At5g51300.1 68418.m06359 splicing factor-related contains simila...    39   0.004
At3g11400.1 68416.m01390 eukaryotic translation initiation facto...    39   0.004
At2g18510.1 68415.m02157 pre-mRNA splicing factor, putative simi...    39   0.004
At1g60650.2 68414.m06828 glycine-rich RNA-binding protein, putat...    39   0.004
At1g60650.1 68414.m06827 glycine-rich RNA-binding protein, putat...    39   0.004
At4g36690.3 68417.m05206 U2 snRNP auxiliary factor large subunit...    38   0.006
At4g36690.2 68417.m05207 U2 snRNP auxiliary factor large subunit...    38   0.006
At4g36690.1 68417.m05205 U2 snRNP auxiliary factor large subunit...    38   0.006
At1g11650.2 68414.m01337 RNA-binding protein 45 (RBP45), putativ...    38   0.006
At1g11650.1 68414.m01336 RNA-binding protein 45 (RBP45), putativ...    38   0.006
At5g54580.1 68418.m06794 RNA recognition motif (RRM)-containing ...    38   0.007
At5g09880.1 68418.m01142 RNA recognition motif (RRM)-containing ...    38   0.007
At4g19610.1 68417.m02881 RNA recognition motif (RRM)-containing ...    38   0.007
At5g64200.2 68418.m08063 arginine/serine-rich splicing factor SC...    38   0.010
At5g64200.1 68418.m08062 arginine/serine-rich splicing factor SC...    38   0.010
At5g54900.1 68418.m06838 RNA-binding protein 45 (RBP45), putativ...    38   0.010
At2g22090.2 68415.m02624 UBP1 interacting protein 1a (UBA1a) nea...    38   0.010
At2g22090.1 68415.m02623 UBP1 interacting protein 1a (UBA1a) nea...    38   0.010
At1g49760.1 68414.m05580 polyadenylate-binding protein, putative...    38   0.010
At4g34110.1 68417.m04839 polyadenylate-binding protein 2 (PABP2)...    37   0.013
At3g52380.1 68416.m05757 33 kDa ribonucleoprotein, chloroplast, ...    37   0.013
At3g19130.1 68416.m02429 RNA-binding protein, putative similar t...    37   0.013
At3g16380.1 68416.m02074 polyadenylate-binding protein, putative...    37   0.013
At1g60900.1 68414.m06856 U2 snRNP auxiliary factor large subunit...    37   0.013
At1g22760.1 68414.m02844 polyadenylate-binding protein 3 (PABP3)       37   0.013
At3g55460.1 68416.m06159 SC35-like splicing factor, 30 kD (SCL30...    37   0.017
At3g20930.1 68416.m02645 RNA recognition motif (RRM)-containing ...    37   0.017
At1g55310.1 68414.m06318 SC35-like splicing factor, 33 kD (SCL33...    36   0.022
At1g34140.1 68414.m04235 polyadenylate-binding protein, putative...    36   0.022
At1g07350.1 68414.m00783 transformer serine/arginine-rich ribonu...    36   0.022
At4g27000.1 68417.m03884 RNA-binding protein 45 (RBP45), putativ...    36   0.039
At3g14100.1 68416.m01782 oligouridylate-binding protein, putativ...    36   0.039
At3g13570.1 68416.m01707 SC35-like splicing factor, 30a kD (SCL3...    36   0.039
At2g43370.1 68415.m05392 U1 small nuclear ribonucleoprotein 70 k...    36   0.039
At2g16940.1 68415.m01952 RNA recognition motif (RRM)-containing ...    36   0.039
At1g73530.1 68414.m08511 RNA recognition motif (RRM)-containing ...    36   0.039
At1g71770.1 68414.m08295 polyadenylate-binding protein 5 (PABP5)...    36   0.039
At1g53720.1 68414.m06113 cyclophilin-RNA interacting protein, pu...    36   0.039
At5g19030.2 68418.m02262 RNA recognition motif (RRM)-containing ...    35   0.052
At5g06000.1 68418.m00665 eukaryotic translation initiation facto...    35   0.052
At4g03110.1 68417.m00420 RNA-binding protein, putative similar t...    35   0.052
At2g44710.1 68415.m05564 RNA recognition motif (RRM)-containing ...    35   0.052
At1g54080.1 68414.m06162 oligouridylate-binding protein, putativ...    35   0.052
At1g16610.2 68414.m01990 arginine/serine-rich protein, putative ...    35   0.052
At1g16610.1 68414.m01989 arginine/serine-rich protein, putative ...    35   0.052
At5g19030.1 68418.m02261 RNA recognition motif (RRM)-containing ...    35   0.068
At5g18810.1 68418.m02235 SC35-like splicing factor, 28 kD (SCL28...    35   0.068
At5g03580.1 68418.m00316 polyadenylate-binding protein, putative...    35   0.068
At1g49600.1 68414.m05561 RNA-binding protein 47 (RBP47), putativ...    35   0.068
At1g07350.2 68414.m00784 transformer serine/arginine-rich ribonu...    35   0.068
At1g03457.2 68414.m00327 RNA-binding protein, putative similar t...    35   0.068
At1g03457.1 68414.m00326 RNA-binding protein, putative similar t...    35   0.068
At5g65260.1 68418.m08209 polyadenylate-binding protein family pr...    34   0.090
At5g59860.1 68418.m07506 RNA recognition motif (RRM)-containing ...    34   0.12 
At5g41690.1 68418.m05067 polyadenylate-binding protein, putative...    33   0.16 
At5g19960.1 68418.m02376 RNA recognition motif (RRM)-containing ...    33   0.16 
At3g52150.1 68416.m05724 RNA recognition motif (RRM)-containing ...    33   0.16 
At3g50670.1 68416.m05542 U1 small nuclear ribonucleoprotein 70 (...    33   0.16 
At3g04500.1 68416.m00477 RNA recognition motif (RRM)-containing ...    33   0.16 
At3g12640.1 68416.m01573 RNA recognition motif (RRM)-containing ...    33   0.21 
At1g60000.1 68414.m06759 29 kDa ribonucleoprotein, chloroplast, ...    33   0.28 
At3g10400.1 68416.m01246 RNA recognition motif (RRM)-containing ...    32   0.36 
At1g17370.1 68414.m02118 oligouridylate-binding protein, putativ...    32   0.36 
At1g13690.1 68414.m01609 RNA recognition motif (RRM)-containing ...    32   0.36 
At5g51120.1 68418.m06339 polyadenylate-binding protein, putative...    32   0.48 
At1g45100.1 68414.m05170 polyadenylate-binding protein, putative...    32   0.48 
At4g10110.1 68417.m01654 RNA recognition motif (RRM)-containing ...    31   0.64 
At4g03110.2 68417.m00421 RNA-binding protein, putative similar t...    31   0.64 
At2g41060.1 68415.m05070 RNA recognition motif (RRM)-containing ...    31   0.64 
At3g56860.3 68416.m06325 UBP1 interacting protein 2a (UBA2a) ide...    31   0.84 
At3g56860.2 68416.m06324 UBP1 interacting protein 2a (UBA2a) ide...    31   0.84 
At3g56860.1 68416.m06323 UBP1 interacting protein 2a (UBA2a) ide...    31   0.84 
At2g39090.1 68415.m04803 tetratricopeptide repeat (TPR)-containi...    31   0.84 
At2g27330.1 68415.m03286 RNA recognition motif (RRM)-containing ...    31   0.84 
At2g24350.1 68415.m02910 RNA recognition motif (RRM)-containing ...    31   0.84 
At4g09040.1 68417.m01491 RNA recognition motif (RRM)-containing ...    31   1.1  
At1g60200.1 68414.m06781 splicing factor PWI domain-containing p...    31   1.1  
At5g10350.2 68418.m01201 polyadenylate-binding protein family pr...    30   1.5  
At5g10350.1 68418.m01200 polyadenylate-binding protein family pr...    30   1.5  
At5g09830.1 68418.m01137 BolA-like family protein contains Pfam ...    30   1.5  
At2g47310.1 68415.m05906 flowering time control protein-related ...    30   1.5  
At1g54080.2 68414.m06163 oligouridylate-binding protein, putativ...    30   1.5  
At5g13010.1 68418.m01491 RNA helicase, putative similar to DEAH-...    29   2.6  
At3g10845.1 68416.m01306 RNA recognition motif (RRM)-containing ...    29   3.4  
At1g72800.1 68414.m08416 nuM1-related contains similarity with n...    29   3.4  
At1g41855.1 68414.m04833 hypothetical protein                          29   3.4  
At4g00830.1 68417.m00114 RNA recognition motif (RRM)-containing ...    29   4.5  
At3g52660.1 68416.m05801 RNA recognition motif (RRM)-containing ...    29   4.5  
At4g38440.1 68417.m05432 expressed protein                             28   5.9  
At4g30150.1 68417.m04287 expressed protein                             28   5.9  
At1g56660.1 68414.m06516 expressed protein                             28   5.9  
At1g02840.3 68414.m00246 pre-mRNA splicing factor SF2 (SF2) / SR...    28   5.9  
At1g02840.2 68414.m00244 pre-mRNA splicing factor SF2 (SF2) / SR...    28   5.9  
At1g02840.1 68414.m00245 pre-mRNA splicing factor SF2 (SF2) / SR...    28   5.9  
At4g35785.2 68417.m05083 transformer serine/arginine-rich ribonu...    28   7.8  
At4g35785.1 68417.m05082 transformer serine/arginine-rich ribonu...    28   7.8  
At1g79100.1 68414.m09223 arginine/serine-rich protein-related si...    28   7.8  

>At5g40490.1 68418.m04910 RNA recognition motif (RRM)-containing
           protein ribonucleoprotein, Xenopus laevis, PIR:S40778;
           contains InterPro entry IPR000504: RNA-binding region
           RNP-1 (RNA recognition motif) (RRM)
          Length = 423

 Score = 67.7 bits (158), Expect = 8e-12
 Identities = 34/87 (39%), Positives = 56/87 (64%), Gaps = 1/87 (1%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEA-QNNRPHKIDGRIVEPKRAVPREEI 431
           +GEI D V+MKD KT + +GFGF+TY+ + +VD+  Q+N  H I G+ VE KR +PR  +
Sbjct: 65  YGEITDSVIMKDRKTGQPRGFGFVTYADSSVVDKVIQDN--HIIIGKQVEIKRTIPRGSM 122

Query: 432 KRPEASATVKKLFVAGLKQDIEEEDLE 512
              +     KK+FV G+   +++++ +
Sbjct: 123 SSNDFK--TKKIFVGGIPSSVDDDEFK 147



 Score = 49.6 bits (113), Expect = 2e-06
 Identities = 30/74 (40%), Positives = 43/74 (58%), Gaps = 2/74 (2%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDE--AQNNRPHKIDGRIVEPKRAVPREE 428
           +GE+ +  +M+D  T RS+GFGF+TY    MVD   A+ NR  ++ G  VE K+A P   
Sbjct: 153 FGELKEHQIMRDHSTGRSRGFGFVTYESEDMVDHLLAKGNR-IELSGTQVEIKKAEP--- 208

Query: 429 IKRPEASATVKKLF 470
            K+P +  T  K F
Sbjct: 209 -KKPNSVTTPSKRF 221



 Score = 45.2 bits (102), Expect = 5e-05
 Identities = 20/48 (41%), Positives = 31/48 (64%)
 Frame = +2

Query: 512 EYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           ++F  +G I    ++ D++TG+ RGFGFV + D   VD+V +Q NH I
Sbjct: 60  KHFGKYGEITDSVIMKDRKTGQPRGFGFVTYADSSVVDKV-IQDNHII 106



 Score = 43.2 bits (97), Expect = 2e-04
 Identities = 17/46 (36%), Positives = 27/46 (58%)
 Frame = +2

Query: 509 REYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQN 646
           +E+F  FG +    ++ D  TG+ RGFGFV ++  D VD +  + N
Sbjct: 147 KEFFMQFGELKEHQIMRDHSTGRSRGFGFVTYESEDMVDHLLAKGN 192


>At4g36960.1 68417.m05238 RNA recognition motif (RRM)-containing
           protein similar to SP|P48809 Heterogeneous nuclear
           ribonucleoprotein 27C (hnRNP 48) {Drosophila
           melanogaster}; contains InterPro entry IPR000504:
           RNA-binding region RNP-1 (RNA recognition motif) (RRM);
           non-consensus TA donor splice site at exon 6
          Length = 379

 Score = 66.1 bits (154), Expect = 2e-11
 Identities = 33/94 (35%), Positives = 54/94 (57%)
 Frame = +3

Query: 234 IKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRA 413
           +K  +  +G++ D +VMKD  T RS+GFG++T++ A     A     H +  RI+E K A
Sbjct: 19  LKDYMSKFGDLEDCIVMKDRSTGRSRGFGYVTFASAEDAKNALKGE-HFLGNRILEVKVA 77

Query: 414 VPREEIKRPEASATVKKLFVAGLKQDIEEEDLES 515
            P+EE+++P    T  ++FVA +   + E D  S
Sbjct: 78  TPKEEMRQPAKKVT--RIFVARIPSSVSESDFRS 109



 Score = 47.6 bits (108), Expect = 9e-06
 Identities = 23/62 (37%), Positives = 36/62 (58%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEIK 434
           +GEI D+ + KD  +K+ +G GFIT+S A  V++   +  H + G  V   RA P+E+  
Sbjct: 114 YGEITDLYMPKDYNSKQHRGIGFITFSSADSVEDLMED-THDLGGTTVAVDRATPKEDDH 172

Query: 435 RP 440
            P
Sbjct: 173 PP 174



 Score = 44.0 bits (99), Expect = 1e-04
 Identities = 24/67 (35%), Positives = 36/67 (53%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEIK 434
           +G I D  + KDPK    +GFGF+T+++  + D     R H+I G+ V    A P +E  
Sbjct: 263 FGHIQDAYIPKDPKRSGHRGFGFVTFAENGVADRVA-RRSHEICGQEVAIDSATPLDE-A 320

Query: 435 RPEASAT 455
            P A A+
Sbjct: 321 GPSAGAS 327



 Score = 41.1 bits (92), Expect = 8e-04
 Identities = 20/50 (40%), Positives = 29/50 (58%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           LR+YF  FG+I    +  D +    RGFGFV F +    DRV  +++H+I
Sbjct: 256 LRDYFGRFGHIQDAYIPKDPKRSGHRGFGFVTFAENGVADRVA-RRSHEI 304



 Score = 39.5 bits (88), Expect = 0.002
 Identities = 15/33 (45%), Positives = 23/33 (69%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEF 604
           L++Y S FG++    V+ D+ TG+ RGFG+V F
Sbjct: 19  LKDYMSKFGDLEDCIVMKDRSTGRSRGFGYVTF 51


>At3g07810.2 68416.m00956 heterogeneous nuclear ribonucleoprotein,
           putative / hnRNP, putative contains Pfam profile:
           PF00076 RNA recognition motif. (a.k.a. RRM, RBD, or RNP
           domain)
          Length = 495

 Score = 65.3 bits (152), Expect = 4e-11
 Identities = 35/106 (33%), Positives = 60/106 (56%), Gaps = 12/106 (11%)
 Frame = +3

Query: 234 IKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRA 413
           +K    ++GE+++ V++KD  T R++GFGF+ ++    V E      H IDGR+VE K+A
Sbjct: 22  LKEYFSSFGEVIEAVILKDRTTGRARGFGFVVFADP-AVAEIVITEKHNIDGRLVEAKKA 80

Query: 414 VPREE---IKRPEASA---------TVKKLFVAGLKQDIEEEDLES 515
           VPR++   + R  +S+           +K+FV GL   + E D ++
Sbjct: 81  VPRDDQNMVNRSNSSSIQGSPGGPGRTRKIFVGGLPSSVTESDFKT 126



 Score = 60.1 bits (139), Expect = 2e-09
 Identities = 29/65 (44%), Positives = 40/65 (61%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEIK 434
           +G   DVVVM D  T+R +GFGFITY     V++      H+++G++VE KRAVP+E   
Sbjct: 131 FGTTTDVVVMYDHNTQRPRGFGFITYDSEEAVEKVLLKTFHELNGKMVEVKRAVPKELSP 190

Query: 435 RPEAS 449
            P  S
Sbjct: 191 GPSRS 195



 Score = 52.0 bits (119), Expect = 4e-07
 Identities = 22/51 (43%), Positives = 33/51 (64%)
 Frame = +2

Query: 503 RLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           RL+EYFS+FG ++   ++ D+ TG+ RGFGFV F D   V  + + + H I
Sbjct: 21  RLKEYFSSFGEVIEAVILKDRTTGRARGFGFVVFAD-PAVAEIVITEKHNI 70



 Score = 44.8 bits (101), Expect = 6e-05
 Identities = 18/49 (36%), Positives = 29/49 (59%)
 Frame = +2

Query: 509 REYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           + YF  FG    V V+ D  T + RGFGF+ +D  + V++V L+  H++
Sbjct: 125 KTYFEQFGTTTDVVVMYDHNTQRPRGFGFITYDSEEAVEKVLLKTFHEL 173



 Score = 31.9 bits (69), Expect = 0.48
 Identities = 12/26 (46%), Positives = 17/26 (65%)
 Frame = +1

Query: 175 PEHTRKLFIGGLDYRTTDSSLKEFYE 252
           P  TRK+F+GGL    T+S  K ++E
Sbjct: 104 PGRTRKIFVGGLPSSVTESDFKTYFE 129



 Score = 27.9 bits (59), Expect = 7.8
 Identities = 10/20 (50%), Positives = 15/20 (75%)
 Frame = +1

Query: 190 KLFIGGLDYRTTDSSLKEFY 249
           KLFIGG+ + T +  LKE++
Sbjct: 7   KLFIGGISWDTNEERLKEYF 26


>At3g07810.1 68416.m00955 heterogeneous nuclear ribonucleoprotein,
           putative / hnRNP, putative contains Pfam profile:
           PF00076 RNA recognition motif. (a.k.a. RRM, RBD, or RNP
           domain)
          Length = 494

 Score = 65.3 bits (152), Expect = 4e-11
 Identities = 35/106 (33%), Positives = 60/106 (56%), Gaps = 12/106 (11%)
 Frame = +3

Query: 234 IKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRA 413
           +K    ++GE+++ V++KD  T R++GFGF+ ++    V E      H IDGR+VE K+A
Sbjct: 22  LKEYFSSFGEVIEAVILKDRTTGRARGFGFVVFADP-AVAEIVITEKHNIDGRLVEAKKA 80

Query: 414 VPREE---IKRPEASA---------TVKKLFVAGLKQDIEEEDLES 515
           VPR++   + R  +S+           +K+FV GL   + E D ++
Sbjct: 81  VPRDDQNMVNRSNSSSIQGSPGGPGRTRKIFVGGLPSSVTESDFKT 126



 Score = 60.1 bits (139), Expect = 2e-09
 Identities = 29/65 (44%), Positives = 40/65 (61%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEIK 434
           +G   DVVVM D  T+R +GFGFITY     V++      H+++G++VE KRAVP+E   
Sbjct: 131 FGTTTDVVVMYDHNTQRPRGFGFITYDSEEAVEKVLLKTFHELNGKMVEVKRAVPKELSP 190

Query: 435 RPEAS 449
            P  S
Sbjct: 191 GPSRS 195



 Score = 52.0 bits (119), Expect = 4e-07
 Identities = 22/51 (43%), Positives = 33/51 (64%)
 Frame = +2

Query: 503 RLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           RL+EYFS+FG ++   ++ D+ TG+ RGFGFV F D   V  + + + H I
Sbjct: 21  RLKEYFSSFGEVIEAVILKDRTTGRARGFGFVVFAD-PAVAEIVITEKHNI 70



 Score = 44.8 bits (101), Expect = 6e-05
 Identities = 18/49 (36%), Positives = 29/49 (59%)
 Frame = +2

Query: 509 REYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           + YF  FG    V V+ D  T + RGFGF+ +D  + V++V L+  H++
Sbjct: 125 KTYFEQFGTTTDVVVMYDHNTQRPRGFGFITYDSEEAVEKVLLKTFHEL 173



 Score = 31.9 bits (69), Expect = 0.48
 Identities = 12/26 (46%), Positives = 17/26 (65%)
 Frame = +1

Query: 175 PEHTRKLFIGGLDYRTTDSSLKEFYE 252
           P  TRK+F+GGL    T+S  K ++E
Sbjct: 104 PGRTRKIFVGGLPSSVTESDFKTYFE 129



 Score = 27.9 bits (59), Expect = 7.8
 Identities = 10/20 (50%), Positives = 15/20 (75%)
 Frame = +1

Query: 190 KLFIGGLDYRTTDSSLKEFY 249
           KLFIGG+ + T +  LKE++
Sbjct: 7   KLFIGGISWDTNEERLKEYF 26


>At3g13224.2 68416.m01658 RNA recognition motif (RRM)-containing
           protein contains InterPro entry IPR000504: RNA-binding
           region RNP-1 (RNA recognition motif) (RRM)
          Length = 358

 Score = 64.9 bits (151), Expect = 6e-11
 Identities = 31/86 (36%), Positives = 51/86 (59%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEIK 434
           +GEI D V+M+D  T + +GFGFIT++   +VD+   +  H I+G+ VE KR +P+    
Sbjct: 42  YGEITDSVIMRDRHTGQPRGFGFITFADPSVVDKVIED-THVINGKQVEIKRTIPKGAGG 100

Query: 435 RPEASATVKKLFVAGLKQDIEEEDLE 512
                   KK+FV G+   + E++L+
Sbjct: 101 NQSKDIKTKKIFVGGIPSTVTEDELK 126



 Score = 49.2 bits (112), Expect = 3e-06
 Identities = 20/47 (42%), Positives = 31/47 (65%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQN 646
           L+++F+ +GN+V   V+ D ET + RGFGFV FD  + VD +  + N
Sbjct: 125 LKDFFAKYGNVVEHQVIRDHETNRSRGFGFVIFDSEEVVDELLSKGN 171



 Score = 44.0 bits (99), Expect = 1e-04
 Identities = 23/67 (34%), Positives = 40/67 (59%), Gaps = 2/67 (2%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDE--AQNNRPHKIDGRIVEPKRAVPREE 428
           +G +V+  V++D +T RS+GFGF+ +    +VDE  ++ N     D + VE K+A P++ 
Sbjct: 132 YGNVVEHQVIRDHETNRSRGFGFVIFDSEEVVDELLSKGNMIDMADTQ-VEIKKAEPKKS 190

Query: 429 IKRPEAS 449
           + R   S
Sbjct: 191 LNRSPPS 197



 Score = 41.9 bits (94), Expect = 4e-04
 Identities = 18/48 (37%), Positives = 29/48 (60%)
 Frame = +2

Query: 512 EYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           ++F  +G I    ++ D+ TG+ RGFGF+ F D   VD+V ++  H I
Sbjct: 37  KHFGKYGEITDSVIMRDRHTGQPRGFGFITFADPSVVDKV-IEDTHVI 83



 Score = 31.1 bits (67), Expect = 0.84
 Identities = 11/35 (31%), Positives = 21/35 (60%)
 Frame = +1

Query: 145 PSESGDDYEEPEHTRKLFIGGLDYRTTDSSLKEFY 249
           P  +G +  +   T+K+F+GG+    T+  LK+F+
Sbjct: 95  PKGAGGNQSKDIKTKKIFVGGIPSTVTEDELKDFF 129


>At3g13224.1 68416.m01657 RNA recognition motif (RRM)-containing
           protein contains InterPro entry IPR000504: RNA-binding
           region RNP-1 (RNA recognition motif) (RRM)
          Length = 231

 Score = 64.9 bits (151), Expect = 6e-11
 Identities = 31/86 (36%), Positives = 51/86 (59%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEIK 434
           +GEI D V+M+D  T + +GFGFIT++   +VD+   +  H I+G+ VE KR +P+    
Sbjct: 42  YGEITDSVIMRDRHTGQPRGFGFITFADPSVVDKVIED-THVINGKQVEIKRTIPKGAGG 100

Query: 435 RPEASATVKKLFVAGLKQDIEEEDLE 512
                   KK+FV G+   + E++L+
Sbjct: 101 NQSKDIKTKKIFVGGIPSTVTEDELK 126



 Score = 49.2 bits (112), Expect = 3e-06
 Identities = 20/47 (42%), Positives = 31/47 (65%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQN 646
           L+++F+ +GN+V   V+ D ET + RGFGFV FD  + VD +  + N
Sbjct: 125 LKDFFAKYGNVVEHQVIRDHETNRSRGFGFVIFDSEEVVDELLSKGN 171



 Score = 41.9 bits (94), Expect = 4e-04
 Identities = 18/48 (37%), Positives = 29/48 (60%)
 Frame = +2

Query: 512 EYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           ++F  +G I    ++ D+ TG+ RGFGF+ F D   VD+V ++  H I
Sbjct: 37  KHFGKYGEITDSVIMRDRHTGQPRGFGFITFADPSVVDKV-IEDTHVI 83



 Score = 37.9 bits (84), Expect = 0.007
 Identities = 14/34 (41%), Positives = 24/34 (70%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDE 356
           +G +V+  V++D +T RS+GFGF+ +    +VDE
Sbjct: 132 YGNVVEHQVIRDHETNRSRGFGFVIFDSEEVVDE 165



 Score = 31.1 bits (67), Expect = 0.84
 Identities = 11/35 (31%), Positives = 21/35 (60%)
 Frame = +1

Query: 145 PSESGDDYEEPEHTRKLFIGGLDYRTTDSSLKEFY 249
           P  +G +  +   T+K+F+GG+    T+  LK+F+
Sbjct: 95  PKGAGGNQSKDIKTKKIFVGGIPSTVTEDELKDFF 129


>At5g55550.3 68418.m06922 RNA recognition motif (RRM)-containing
           protein similar to DAZ associated protein 1 [Homo
           sapiens] GI:8671754; contains InterPro entry IPR000504:
           RNA-binding region RNP-1 (RNA recognition motif) (RRM)
          Length = 460

 Score = 62.1 bits (144), Expect = 4e-10
 Identities = 28/57 (49%), Positives = 39/57 (68%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPRE 425
           +G I DVVVM D  T+R +GFGFIT+     VD   +   H+++G++VE KRAVP+E
Sbjct: 133 FGTIADVVVMYDHNTQRPRGFGFITFDSDDAVDRVLHKTFHELNGKLVEVKRAVPKE 189



 Score = 60.1 bits (139), Expect = 2e-09
 Identities = 37/101 (36%), Positives = 56/101 (55%), Gaps = 14/101 (13%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREE-- 428
           +G++V+ V+M+D  T R++GFGFI ++    V E      H IDGR VE K+AVPR++  
Sbjct: 29  YGDVVEAVIMRDRATGRARGFGFIVFADP-CVSERVIMDKHIIDGRTVEAKKAVPRDDQQ 87

Query: 429 -IKRPEA-----------SATVKKLFVAGLKQDIEEEDLES 515
            +KR  +               KK+FV GL   I EE+ ++
Sbjct: 88  VLKRHASPIHLMSPVHGGGGRTKKIFVGGLPSSITEEEFKN 128



 Score = 50.0 bits (114), Expect = 2e-06
 Identities = 20/48 (41%), Positives = 33/48 (68%)
 Frame = +2

Query: 503 RLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQN 646
           RLR+YFS +G++V   ++ D+ TG+ RGFGF+ F D    +RV + ++
Sbjct: 21  RLRDYFSNYGDVVEAVIMRDRATGRARGFGFIVFADPCVSERVIMDKH 68



 Score = 49.6 bits (113), Expect = 2e-06
 Identities = 22/49 (44%), Positives = 29/49 (59%)
 Frame = +2

Query: 509 REYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           + YF  FG I  V V+ D  T + RGFGF+ FD  D VDRV  +  H++
Sbjct: 127 KNYFDQFGTIADVVVMYDHNTQRPRGFGFITFDSDDAVDRVLHKTFHEL 175


>At5g55550.2 68418.m06921 RNA recognition motif (RRM)-containing
           protein similar to DAZ associated protein 1 [Homo
           sapiens] GI:8671754; contains InterPro entry IPR000504:
           RNA-binding region RNP-1 (RNA recognition motif) (RRM)
          Length = 460

 Score = 62.1 bits (144), Expect = 4e-10
 Identities = 28/57 (49%), Positives = 39/57 (68%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPRE 425
           +G I DVVVM D  T+R +GFGFIT+     VD   +   H+++G++VE KRAVP+E
Sbjct: 133 FGTIADVVVMYDHNTQRPRGFGFITFDSDDAVDRVLHKTFHELNGKLVEVKRAVPKE 189



 Score = 60.1 bits (139), Expect = 2e-09
 Identities = 37/101 (36%), Positives = 56/101 (55%), Gaps = 14/101 (13%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREE-- 428
           +G++V+ V+M+D  T R++GFGFI ++    V E      H IDGR VE K+AVPR++  
Sbjct: 29  YGDVVEAVIMRDRATGRARGFGFIVFADP-CVSERVIMDKHIIDGRTVEAKKAVPRDDQQ 87

Query: 429 -IKRPEA-----------SATVKKLFVAGLKQDIEEEDLES 515
            +KR  +               KK+FV GL   I EE+ ++
Sbjct: 88  VLKRHASPIHLMSPVHGGGGRTKKIFVGGLPSSITEEEFKN 128



 Score = 50.0 bits (114), Expect = 2e-06
 Identities = 20/48 (41%), Positives = 33/48 (68%)
 Frame = +2

Query: 503 RLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQN 646
           RLR+YFS +G++V   ++ D+ TG+ RGFGF+ F D    +RV + ++
Sbjct: 21  RLRDYFSNYGDVVEAVIMRDRATGRARGFGFIVFADPCVSERVIMDKH 68



 Score = 49.6 bits (113), Expect = 2e-06
 Identities = 22/49 (44%), Positives = 29/49 (59%)
 Frame = +2

Query: 509 REYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           + YF  FG I  V V+ D  T + RGFGF+ FD  D VDRV  +  H++
Sbjct: 127 KNYFDQFGTIADVVVMYDHNTQRPRGFGFITFDSDDAVDRVLHKTFHEL 175


>At5g55550.1 68418.m06920 RNA recognition motif (RRM)-containing
           protein similar to DAZ associated protein 1 [Homo
           sapiens] GI:8671754; contains InterPro entry IPR000504:
           RNA-binding region RNP-1 (RNA recognition motif) (RRM)
          Length = 448

 Score = 62.1 bits (144), Expect = 4e-10
 Identities = 28/57 (49%), Positives = 39/57 (68%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPRE 425
           +G I DVVVM D  T+R +GFGFIT+     VD   +   H+++G++VE KRAVP+E
Sbjct: 133 FGTIADVVVMYDHNTQRPRGFGFITFDSDDAVDRVLHKTFHELNGKLVEVKRAVPKE 189



 Score = 60.1 bits (139), Expect = 2e-09
 Identities = 37/101 (36%), Positives = 56/101 (55%), Gaps = 14/101 (13%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREE-- 428
           +G++V+ V+M+D  T R++GFGFI ++    V E      H IDGR VE K+AVPR++  
Sbjct: 29  YGDVVEAVIMRDRATGRARGFGFIVFADP-CVSERVIMDKHIIDGRTVEAKKAVPRDDQQ 87

Query: 429 -IKRPEA-----------SATVKKLFVAGLKQDIEEEDLES 515
            +KR  +               KK+FV GL   I EE+ ++
Sbjct: 88  VLKRHASPIHLMSPVHGGGGRTKKIFVGGLPSSITEEEFKN 128



 Score = 50.0 bits (114), Expect = 2e-06
 Identities = 20/48 (41%), Positives = 33/48 (68%)
 Frame = +2

Query: 503 RLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQN 646
           RLR+YFS +G++V   ++ D+ TG+ RGFGF+ F D    +RV + ++
Sbjct: 21  RLRDYFSNYGDVVEAVIMRDRATGRARGFGFIVFADPCVSERVIMDKH 68



 Score = 49.6 bits (113), Expect = 2e-06
 Identities = 22/49 (44%), Positives = 29/49 (59%)
 Frame = +2

Query: 509 REYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           + YF  FG I  V V+ D  T + RGFGF+ FD  D VDRV  +  H++
Sbjct: 127 KNYFDQFGTIADVVVMYDHNTQRPRGFGFITFDSDDAVDRVLHKTFHEL 175


>At4g26650.1 68417.m03840 RNA recognition motif (RRM)-containing
           protein contains Pfam profile: PF00076 RNA recognition
           motif. (a.k.a. RRM, RBD, or RNP domain)
          Length = 455

 Score = 61.7 bits (143), Expect = 5e-10
 Identities = 28/57 (49%), Positives = 39/57 (68%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPRE 425
           +G I DVVVM D  T+R +GFGFIT+     VD   +   H+++G++VE KRAVP+E
Sbjct: 145 FGTIADVVVMYDHNTQRPRGFGFITFDSEESVDMVLHKTFHELNGKMVEVKRAVPKE 201



 Score = 57.6 bits (133), Expect = 8e-09
 Identities = 36/104 (34%), Positives = 58/104 (55%), Gaps = 17/104 (16%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREE-- 428
           +G++V+ V+M+D  T R++GFGFI ++   + +    ++ H IDGR VE K+AVPR++  
Sbjct: 38  YGDLVEAVIMRDRTTGRARGFGFIVFADPSVAERVIMDK-HIIDGRTVEAKKAVPRDDQQ 96

Query: 429 -IKR---------PE-----ASATVKKLFVAGLKQDIEEEDLES 515
            +KR         P        A  KK+FV GL   I E + ++
Sbjct: 97  VLKRHASPMHLISPSHGGNGGGARTKKIFVGGLPSSITEAEFKN 140



 Score = 49.2 bits (112), Expect = 3e-06
 Identities = 19/48 (39%), Positives = 32/48 (66%)
 Frame = +2

Query: 503 RLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQN 646
           RL+EYF  +G++V   ++ D+ TG+ RGFGF+ F D    +RV + ++
Sbjct: 30  RLQEYFGKYGDLVEAVIMRDRTTGRARGFGFIVFADPSVAERVIMDKH 77



 Score = 46.0 bits (104), Expect = 3e-05
 Identities = 20/49 (40%), Positives = 28/49 (57%)
 Frame = +2

Query: 509 REYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           + YF  FG I  V V+ D  T + RGFGF+ FD  + VD V  +  H++
Sbjct: 139 KNYFDQFGTIADVVVMYDHNTQRPRGFGFITFDSEESVDMVLHKTFHEL 187


>At5g47620.2 68418.m05879 heterogeneous nuclear ribonucleoprotein,
           putative / hnRNP, putative
          Length = 431

 Score = 60.9 bits (141), Expect = 9e-10
 Identities = 31/97 (31%), Positives = 57/97 (58%), Gaps = 10/97 (10%)
 Frame = +3

Query: 252 AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREE- 428
           ++GE+++ V+MKD  T R++GFGF+ ++  ++ +     + H IDG+IVE K+AVPR++ 
Sbjct: 28  SFGEVLEAVIMKDRATGRARGFGFVVFADPNVAERVVLLK-HIIDGKIVEAKKAVPRDDH 86

Query: 429 ---------IKRPEASATVKKLFVAGLKQDIEEEDLE 512
                    ++     +  KK+FV GL   + E + +
Sbjct: 87  VVFNKSNSSLQGSPGPSNSKKIFVGGLASSVTEAEFK 123



 Score = 59.3 bits (137), Expect = 3e-09
 Identities = 27/63 (42%), Positives = 41/63 (65%)
 Frame = +3

Query: 237 KRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAV 416
           K+    +G I DVVVM D +T+R +GFGFI+Y     VD+      H+++G++VE K AV
Sbjct: 123 KKYFAQFGMITDVVVMYDHRTQRPRGFGFISYDSEEAVDKVLQKTFHELNGKMVEVKLAV 182

Query: 417 PRE 425
           P++
Sbjct: 183 PKD 185



 Score = 50.8 bits (116), Expect = 1e-06
 Identities = 21/45 (46%), Positives = 31/45 (68%)
 Frame = +2

Query: 503 RLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCL 637
           RLR+YF +FG ++   ++ D+ TG+ RGFGFV F D +  +RV L
Sbjct: 21  RLRDYFHSFGEVLEAVIMKDRATGRARGFGFVVFADPNVAERVVL 65



 Score = 46.8 bits (106), Expect = 2e-05
 Identities = 19/49 (38%), Positives = 31/49 (63%)
 Frame = +2

Query: 509 REYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           ++YF+ FG I  V V+ D  T + RGFGF+ +D  + VD+V  +  H++
Sbjct: 123 KKYFAQFGMITDVVVMYDHRTQRPRGFGFISYDSEEAVDKVLQKTFHEL 171



 Score = 27.9 bits (59), Expect = 7.8
 Identities = 12/27 (44%), Positives = 19/27 (70%), Gaps = 1/27 (3%)
 Frame = +1

Query: 190 KLFIGGLDYRTTDSSLKE-FYEHGEKL 267
           KLFIGG+ + T++  L++ F+  GE L
Sbjct: 7   KLFIGGISWETSEDRLRDYFHSFGEVL 33


>At5g47620.1 68418.m05878 heterogeneous nuclear ribonucleoprotein,
           putative / hnRNP, putative
          Length = 431

 Score = 60.9 bits (141), Expect = 9e-10
 Identities = 31/97 (31%), Positives = 57/97 (58%), Gaps = 10/97 (10%)
 Frame = +3

Query: 252 AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREE- 428
           ++GE+++ V+MKD  T R++GFGF+ ++  ++ +     + H IDG+IVE K+AVPR++ 
Sbjct: 28  SFGEVLEAVIMKDRATGRARGFGFVVFADPNVAERVVLLK-HIIDGKIVEAKKAVPRDDH 86

Query: 429 ---------IKRPEASATVKKLFVAGLKQDIEEEDLE 512
                    ++     +  KK+FV GL   + E + +
Sbjct: 87  VVFNKSNSSLQGSPGPSNSKKIFVGGLASSVTEAEFK 123



 Score = 59.3 bits (137), Expect = 3e-09
 Identities = 27/63 (42%), Positives = 41/63 (65%)
 Frame = +3

Query: 237 KRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAV 416
           K+    +G I DVVVM D +T+R +GFGFI+Y     VD+      H+++G++VE K AV
Sbjct: 123 KKYFAQFGMITDVVVMYDHRTQRPRGFGFISYDSEEAVDKVLQKTFHELNGKMVEVKLAV 182

Query: 417 PRE 425
           P++
Sbjct: 183 PKD 185



 Score = 50.8 bits (116), Expect = 1e-06
 Identities = 21/45 (46%), Positives = 31/45 (68%)
 Frame = +2

Query: 503 RLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCL 637
           RLR+YF +FG ++   ++ D+ TG+ RGFGFV F D +  +RV L
Sbjct: 21  RLRDYFHSFGEVLEAVIMKDRATGRARGFGFVVFADPNVAERVVL 65



 Score = 46.8 bits (106), Expect = 2e-05
 Identities = 19/49 (38%), Positives = 31/49 (63%)
 Frame = +2

Query: 509 REYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           ++YF+ FG I  V V+ D  T + RGFGF+ +D  + VD+V  +  H++
Sbjct: 123 KKYFAQFGMITDVVVMYDHRTQRPRGFGFISYDSEEAVDKVLQKTFHEL 171



 Score = 27.9 bits (59), Expect = 7.8
 Identities = 12/27 (44%), Positives = 19/27 (70%), Gaps = 1/27 (3%)
 Frame = +1

Query: 190 KLFIGGLDYRTTDSSLKE-FYEHGEKL 267
           KLFIGG+ + T++  L++ F+  GE L
Sbjct: 7   KLFIGGISWETSEDRLRDYFHSFGEVL 33


>At2g33410.1 68415.m04095 heterogeneous nuclear ribonucleoprotein,
           putative / hnRNP, putative 
          Length = 404

 Score = 60.1 bits (139), Expect = 2e-09
 Identities = 28/50 (56%), Positives = 35/50 (70%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           LREYFS FG ++ V+V+ +K TG+ RGFGFV F D   +DRV LQ  H I
Sbjct: 22  LREYFSNFGEVLQVTVMREKATGRPRGFGFVAFSDPAVIDRV-LQDKHHI 70



 Score = 53.6 bits (123), Expect = 1e-07
 Identities = 24/58 (41%), Positives = 38/58 (65%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREE 428
           +GE++ V VM++  T R +GFGF+ +S   ++D    ++ H ID R V+ KRA+ REE
Sbjct: 29  FGEVLQVTVMREKATGRPRGFGFVAFSDPAVIDRVLQDK-HHIDNRDVDVKRAMSREE 85



 Score = 50.8 bits (116), Expect = 1e-06
 Identities = 21/57 (36%), Positives = 36/57 (63%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPRE 425
           +G + D V+M D  T+R +GFGF+++     VD   +   H ++G+ VE KRA+P++
Sbjct: 133 YGPVSDAVIMIDQTTQRPRGFGFVSFDSEDSVDLVLHKTFHDLNGKQVEVKRALPKD 189



 Score = 46.0 bits (104), Expect = 3e-05
 Identities = 20/49 (40%), Positives = 28/49 (57%)
 Frame = +2

Query: 509 REYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           R YF T+G +    ++ D+ T + RGFGFV FD  D VD V  +  H +
Sbjct: 127 RAYFETYGPVSDAVIMIDQTTQRPRGFGFVSFDSEDSVDLVLHKTFHDL 175


>At1g17640.1 68414.m02183 RNA recognition motif (RRM)-containing
           protein similar to GB:L02953 from [Xenopus laevis]
           (Nucleic Acids Res. 21, 999-1006 (1993)); contains
           InterPro entry IPR000504: RNA-binding region RNP-1 (RNA
           recognition motif) (RRM)
          Length = 369

 Score = 59.7 bits (138), Expect = 2e-09
 Identities = 33/88 (37%), Positives = 54/88 (61%), Gaps = 1/88 (1%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPR-EEI 431
           +GE+VD V+M D  T   +GFGF+T++ +  V E      H ID R V+ KR +PR ++ 
Sbjct: 89  FGEVVDSVIMTDRITGNPRGFGFVTFADS-AVAEKVLEEDHVIDDRKVDLKRTLPRGDKD 147

Query: 432 KRPEASATVKKLFVAGLKQDIEEEDLES 515
              +A +  +K+FV GL   +EE++L++
Sbjct: 148 TDIKAVSKTRKIFVGGLPPLLEEDELKN 175



 Score = 47.6 bits (108), Expect = 9e-06
 Identities = 19/42 (45%), Positives = 27/42 (64%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRV 631
           L+ YF  +G+I+   ++ D  TG+ RGFGFV F   D VDR+
Sbjct: 173 LKNYFCVYGDIIEHQIMYDHHTGRSRGFGFVTFQTEDSVDRL 214



 Score = 46.0 bits (104), Expect = 3e-05
 Identities = 22/64 (34%), Positives = 37/64 (57%), Gaps = 1/64 (1%)
 Frame = +3

Query: 234 IKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEA-QNNRPHKIDGRIVEPKR 410
           +K     +G+I++  +M D  T RS+GFGF+T+     VD    + + H++  + VE KR
Sbjct: 173 LKNYFCVYGDIIEHQIMYDHHTGRSRGFGFVTFQTEDSVDRLFSDGKVHELGDKQVEIKR 232

Query: 411 AVPR 422
           A P+
Sbjct: 233 AEPK 236



 Score = 45.6 bits (103), Expect = 4e-05
 Identities = 21/47 (44%), Positives = 30/47 (63%)
 Frame = +2

Query: 515 YFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           YF  FG +V   ++TD+ TG  RGFGFV F D    ++V L+++H I
Sbjct: 85  YFGKFGEVVDSVIMTDRITGNPRGFGFVTFADSAVAEKV-LEEDHVI 130


>At5g47620.3 68418.m05877 heterogeneous nuclear ribonucleoprotein,
           putative / hnRNP, putative
          Length = 358

 Score = 59.3 bits (137), Expect = 3e-09
 Identities = 27/63 (42%), Positives = 41/63 (65%)
 Frame = +3

Query: 237 KRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAV 416
           K+    +G I DVVVM D +T+R +GFGFI+Y     VD+      H+++G++VE K AV
Sbjct: 50  KKYFAQFGMITDVVVMYDHRTQRPRGFGFISYDSEEAVDKVLQKTFHELNGKMVEVKLAV 109

Query: 417 PRE 425
           P++
Sbjct: 110 PKD 112



 Score = 46.8 bits (106), Expect = 2e-05
 Identities = 19/49 (38%), Positives = 31/49 (63%)
 Frame = +2

Query: 509 REYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           ++YF+ FG I  V V+ D  T + RGFGF+ +D  + VD+V  +  H++
Sbjct: 50  KKYFAQFGMITDVVVMYDHRTQRPRGFGFISYDSEEAVDKVLQKTFHEL 98


>At1g58470.1 68414.m06651 RNA-binding protein (XF41) identical to
           RNA binding protein GI:18181938 from (Arabidopsis
           thaliana); contains InterPro entry IPR000504:
           RNA-binding region RNP-1 (RNA recognition motif) (RRM)
           domain 15450911 gb AY054536.1
          Length = 360

 Score = 56.4 bits (130), Expect = 2e-08
 Identities = 26/66 (39%), Positives = 38/66 (57%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEIK 434
           +G   DVVVM D  T R +GFGF+TY     V+    +  H++  + VE KRA+P+E I+
Sbjct: 143 FGRTTDVVVMHDGVTNRPRGFGFVTYDSEDSVEVVMQSNFHELSDKRVEVKRAIPKEGIQ 202

Query: 435 RPEASA 452
               +A
Sbjct: 203 SNNGNA 208



 Score = 43.2 bits (97), Expect = 2e-04
 Identities = 20/40 (50%), Positives = 27/40 (67%), Gaps = 1/40 (2%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEF-DDYDPV 622
           L++YFS +G ++   V  +K TGK RGFGFV F +D D V
Sbjct: 22  LKQYFSRYGAVLEAVVAKEKVTGKPRGFGFVRFANDCDVV 61



 Score = 42.3 bits (95), Expect = 3e-04
 Identities = 19/49 (38%), Positives = 26/49 (53%)
 Frame = +2

Query: 509 REYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           + YF  FG    V V+ D  T + RGFGFV +D  D V+ V     H++
Sbjct: 137 KSYFERFGRTTDVVVMHDGVTNRPRGFGFVTYDSEDSVEVVMQSNFHEL 185



 Score = 35.9 bits (79), Expect = 0.030
 Identities = 18/66 (27%), Positives = 39/66 (59%)
 Frame = +3

Query: 234 IKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRA 413
           +K+    +G +++ VV K+  T + +GFGF+ ++    V +A  +  H I G+ V+ ++A
Sbjct: 22  LKQYFSRYGAVLEAVVAKEKVTGKPRGFGFVRFANDCDVVKALRD-THFILGKPVDVRKA 80

Query: 414 VPREEI 431
           + + E+
Sbjct: 81  IRKHEL 86



 Score = 30.3 bits (65), Expect = 1.5
 Identities = 10/23 (43%), Positives = 16/23 (69%)
 Frame = +1

Query: 184 TRKLFIGGLDYRTTDSSLKEFYE 252
           T+K+F+GGL   TT+   K ++E
Sbjct: 119 TKKIFVGGLSSNTTEEEFKSYFE 141


>At4g14300.1 68417.m02203 heterogeneous nuclear ribonucleoprotein,
           putative / hnRNP, putative 
          Length = 411

 Score = 53.2 bits (122), Expect = 2e-07
 Identities = 25/51 (49%), Positives = 34/51 (66%)
 Frame = +2

Query: 503 RLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           +LRE+F+ +G +    V+ DK TG+ RGFGFV F D   +DRV LQ+ H I
Sbjct: 21  KLREHFTNYGEVSQAIVMRDKLTGRPRGFGFVIFSDPSVLDRV-LQEKHSI 70



 Score = 52.4 bits (120), Expect = 3e-07
 Identities = 21/57 (36%), Positives = 34/57 (59%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPRE 425
           +G + DV +M D  T R +GFGF+++     VD   +   H + G+ VE KRA+P++
Sbjct: 133 YGPVTDVAIMYDQATNRPRGFGFVSFDSEDAVDSVLHKTFHDLSGKQVEVKRALPKD 189



 Score = 52.0 bits (119), Expect = 4e-07
 Identities = 24/58 (41%), Positives = 36/58 (62%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREE 428
           +GE+   +VM+D  T R +GFGF+ +S   ++D     + H ID R V+ KRA+ REE
Sbjct: 29  YGEVSQAIVMRDKLTGRPRGFGFVIFSDPSVLDRVLQEK-HSIDTREVDVKRAMSREE 85



 Score = 49.6 bits (113), Expect = 2e-06
 Identities = 20/49 (40%), Positives = 30/49 (61%)
 Frame = +2

Query: 509 REYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           R+YF  +G +  V+++ D+ T + RGFGFV FD  D VD V  +  H +
Sbjct: 127 RQYFEVYGPVTDVAIMYDQATNRPRGFGFVSFDSEDAVDSVLHKTFHDL 175



 Score = 33.5 bits (73), Expect = 0.16
 Identities = 15/40 (37%), Positives = 23/40 (57%)
 Frame = +1

Query: 133 LNMKPSESGDDYEEPEHTRKLFIGGLDYRTTDSSLKEFYE 252
           LN   S  GD Y +   T+K+F+GGL    TD   ++++E
Sbjct: 95  LNTSRSSGGDAYNK---TKKIFVGGLPPTLTDEEFRQYFE 131


>At2g46780.1 68415.m05836 RNA recognition motif (RRM)-containing
           protein contains InterPro entry IPR000504: RNA-binding
           region RNP-1 (RNA recognition motif) (RRM)
          Length = 304

 Score = 53.2 bits (122), Expect = 2e-07
 Identities = 22/50 (44%), Positives = 29/50 (58%)
 Frame = +2

Query: 497 RRRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQN 646
           R  +R YF  FG IV   V+TDK TG+ +G+GFV F + +   R C   N
Sbjct: 35  RDTMRRYFEQFGEIVEAVVITDKNTGRSKGYGFVTFKEAEAAMRACQNMN 84



 Score = 48.8 bits (111), Expect = 4e-06
 Identities = 27/72 (37%), Positives = 37/72 (51%)
 Frame = +3

Query: 234 IKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRA 413
           ++R    +GEIV+ VV+ D  T RSKG+GF+T+ +A     A  N    IDGR      A
Sbjct: 38  MRRYFEQFGEIVEAVVITDKNTGRSKGYGFVTFKEAEAAMRACQNMNPVIDGRRANCNLA 97

Query: 414 VPREEIKRPEAS 449
               +  RP  S
Sbjct: 98  CLGAQKPRPPTS 109


>At1g33470.2 68414.m04143 RNA recognition motif (RRM)-containing
           protein similar to RRM-containing protein SEB-4 [Xenopus
           laevis] GI:8895698; contains InterPro entry IPR000504:
           RNA-binding region RNP-1 (RNA recognition motif) (RRM)
          Length = 244

 Score = 51.2 bits (117), Expect = 7e-07
 Identities = 20/44 (45%), Positives = 29/44 (65%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCL 637
           LR YF  FG+IV   V+TDK +G+ +G+GFV F D +   + C+
Sbjct: 23  LRNYFEQFGDIVEAVVITDKSSGRSKGYGFVTFCDPEAAQKACV 66



 Score = 41.5 bits (93), Expect = 6e-04
 Identities = 19/57 (33%), Positives = 32/57 (56%)
 Frame = +3

Query: 222 HRFFIKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGR 392
           H+  ++     +G+IV+ VV+ D  + RSKG+GF+T+       +A  +    IDGR
Sbjct: 19  HKVSLRNYFEQFGDIVEAVVITDKSSGRSKGYGFVTFCDPEAAQKACVDPAPVIDGR 75


>At1g33470.1 68414.m04142 RNA recognition motif (RRM)-containing
           protein similar to RRM-containing protein SEB-4 [Xenopus
           laevis] GI:8895698; contains InterPro entry IPR000504:
           RNA-binding region RNP-1 (RNA recognition motif) (RRM)
          Length = 245

 Score = 51.2 bits (117), Expect = 7e-07
 Identities = 20/44 (45%), Positives = 29/44 (65%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCL 637
           LR YF  FG+IV   V+TDK +G+ +G+GFV F D +   + C+
Sbjct: 23  LRNYFEQFGDIVEAVVITDKSSGRSKGYGFVTFCDPEAAQKACV 66



 Score = 41.5 bits (93), Expect = 6e-04
 Identities = 19/57 (33%), Positives = 32/57 (56%)
 Frame = +3

Query: 222 HRFFIKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGR 392
           H+  ++     +G+IV+ VV+ D  + RSKG+GF+T+       +A  +    IDGR
Sbjct: 19  HKVSLRNYFEQFGDIVEAVVITDKSSGRSKGYGFVTFCDPEAAQKACVDPAPVIDGR 75


>At1g22330.1 68414.m02793 RNA recognition motif (RRM)-containing
           protein similar to UBP1 interacting protein 1a
           [Arabidopsis thaliana] GI:19574236; contains InterPro
           entry IPR000504: RNA-binding region RNP-1 (RNA
           recognition motif) (RRM)
          Length = 146

 Score = 51.2 bits (117), Expect = 7e-07
 Identities = 21/47 (44%), Positives = 27/47 (57%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQN 646
           +R YF  FG I+   ++TDK TGK +G+GFV F D D   R     N
Sbjct: 33  MRRYFDQFGEILEAVIITDKATGKSKGYGFVTFRDSDSATRAVADPN 79



 Score = 39.9 bits (89), Expect = 0.002
 Identities = 18/53 (33%), Positives = 31/53 (58%)
 Frame = +3

Query: 234 IKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGR 392
           ++R    +GEI++ V++ D  T +SKG+GF+T+  +     A  +    IDGR
Sbjct: 33  MRRYFDQFGEILEAVIITDKATGKSKGYGFVTFRDSDSATRAVADPNPVIDGR 85


>At1g78260.2 68414.m09119 RNA recognition motif (RRM)-containing
           protein similar to RNA recognition motif-containing
           protein SEB-4 GI:8895698 from [Xenopus laevis]; contains
           InterPro entry IPR000504: RNA-binding region RNP-1 (RNA
           recognition motif) (RRM)
          Length = 271

 Score = 50.0 bits (114), Expect = 2e-06
 Identities = 20/47 (42%), Positives = 27/47 (57%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQN 646
           +R YF  FG I+   ++TDK TGK +G+GFV F + D   R     N
Sbjct: 33  MRRYFEQFGEILEAVIITDKNTGKSKGYGFVTFRESDSATRAVADPN 79



 Score = 41.1 bits (92), Expect = 8e-04
 Identities = 18/53 (33%), Positives = 32/53 (60%)
 Frame = +3

Query: 234 IKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGR 392
           ++R    +GEI++ V++ D  T +SKG+GF+T+ ++     A  +    IDGR
Sbjct: 33  MRRYFEQFGEILEAVIITDKNTGKSKGYGFVTFRESDSATRAVADPNPVIDGR 85


>At1g78260.1 68414.m09120 RNA recognition motif (RRM)-containing
           protein similar to RNA recognition motif-containing
           protein SEB-4 GI:8895698 from [Xenopus laevis]; contains
           InterPro entry IPR000504: RNA-binding region RNP-1 (RNA
           recognition motif) (RRM)
          Length = 287

 Score = 50.0 bits (114), Expect = 2e-06
 Identities = 20/47 (42%), Positives = 27/47 (57%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQN 646
           +R YF  FG I+   ++TDK TGK +G+GFV F + D   R     N
Sbjct: 33  MRRYFEQFGEILEAVIITDKNTGKSKGYGFVTFRESDSATRAVADPN 79



 Score = 41.1 bits (92), Expect = 8e-04
 Identities = 18/53 (33%), Positives = 32/53 (60%)
 Frame = +3

Query: 234 IKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGR 392
           ++R    +GEI++ V++ D  T +SKG+GF+T+ ++     A  +    IDGR
Sbjct: 33  MRRYFEQFGEILEAVIITDKNTGKSKGYGFVTFRESDSATRAVADPNPVIDGR 85


>At4g13850.2 68417.m02146 glycine-rich RNA-binding protein (GRP2)
           glycine-rich RNA binding protein 2 AtGRP2 [Arabidopsis
           thaliana] GI:2826811
          Length = 153

 Score = 49.6 bits (113), Expect = 2e-06
 Identities = 19/35 (54%), Positives = 27/35 (77%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDD 610
           LR+ F+ FG++V   V+ D+ETG+ RGFGFV F+D
Sbjct: 51  LRDAFAHFGDVVDAKVIVDRETGRSRGFGFVNFND 85



 Score = 34.7 bits (76), Expect = 0.068
 Identities = 19/62 (30%), Positives = 32/62 (51%), Gaps = 1/62 (1%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHK-IDGRIVEPKRAVPREEI 431
           +G++VD  V+ D +T RS+GFGF+ ++       A +    K ++GR +    A  R   
Sbjct: 58  FGDVVDAKVIVDRETGRSRGFGFVNFNDEGAATAAISEMDGKELNGRHIRVNPANDRPSA 117

Query: 432 KR 437
            R
Sbjct: 118 PR 119



 Score = 30.7 bits (66), Expect = 1.1
 Identities = 12/22 (54%), Positives = 17/22 (77%)
 Frame = +1

Query: 190 KLFIGGLDYRTTDSSLKEFYEH 255
           KLFIGGL + T D+SL++ + H
Sbjct: 36  KLFIGGLSWGTDDASLRDAFAH 57


>At4g13850.1 68417.m02145 glycine-rich RNA-binding protein (GRP2)
           glycine-rich RNA binding protein 2 AtGRP2 [Arabidopsis
           thaliana] GI:2826811
          Length = 158

 Score = 49.6 bits (113), Expect = 2e-06
 Identities = 19/35 (54%), Positives = 27/35 (77%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDD 610
           LR+ F+ FG++V   V+ D+ETG+ RGFGFV F+D
Sbjct: 51  LRDAFAHFGDVVDAKVIVDRETGRSRGFGFVNFND 85



 Score = 34.7 bits (76), Expect = 0.068
 Identities = 19/62 (30%), Positives = 32/62 (51%), Gaps = 1/62 (1%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHK-IDGRIVEPKRAVPREEI 431
           +G++VD  V+ D +T RS+GFGF+ ++       A +    K ++GR +    A  R   
Sbjct: 58  FGDVVDAKVIVDRETGRSRGFGFVNFNDEGAATAAISEMDGKELNGRHIRVNPANDRPSA 117

Query: 432 KR 437
            R
Sbjct: 118 PR 119



 Score = 30.7 bits (66), Expect = 1.1
 Identities = 12/22 (54%), Positives = 17/22 (77%)
 Frame = +1

Query: 190 KLFIGGLDYRTTDSSLKEFYEH 255
           KLFIGGL + T D+SL++ + H
Sbjct: 36  KLFIGGLSWGTDDASLRDAFAH 57


>At5g53720.1 68418.m06676 RNA recognition motif (RRM)-containing
           protein contains InterPro entry IPR000504: RNA-binding
           region RNP-1 (RNA recognition motif) (RRM)
          Length = 100

 Score = 49.2 bits (112), Expect = 3e-06
 Identities = 25/53 (47%), Positives = 31/53 (58%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRA 413
           +GEIV   V+ D  T+RSKGFGF+T+ +      A  N  H IDGR V  K A
Sbjct: 32  FGEIVYAKVVCDGATQRSKGFGFVTFREVESATRACENPNHTIDGRTVNCKLA 84



 Score = 47.2 bits (107), Expect = 1e-05
 Identities = 22/50 (44%), Positives = 26/50 (52%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           L  YF  FG IV   VV D  T + +GFGFV F + +   R C   NH I
Sbjct: 25  LISYFERFGEIVYAKVVCDGATQRSKGFGFVTFREVESATRACENPNHTI 74


>At1g20880.1 68414.m02615 RNA recognition motif (RRM)-containing
           protein similar to RRM-containing protein SEB-4 [Xenopus
           laevis] GI:8895698; contains InterPro entry IPR000504:
           RNA-binding region RNP-1 (RNA recognition motif) (RRM);
           is the location of EST 197B1T7 , gb|AA597386
          Length = 274

 Score = 49.2 bits (112), Expect = 3e-06
 Identities = 19/44 (43%), Positives = 29/44 (65%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCL 637
           LR +F  +G+I+   V+TDK TG+ +G+GFV F D +   R C+
Sbjct: 40  LRRHFDQYGDILEAVVITDKNTGRSKGYGFVTFRDPEAARRACV 83



 Score = 39.1 bits (87), Expect = 0.003
 Identities = 19/53 (35%), Positives = 30/53 (56%)
 Frame = +3

Query: 234 IKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGR 392
           ++R    +G+I++ VV+ D  T RSKG+GF+T+        A  +    IDGR
Sbjct: 40  LRRHFDQYGDILEAVVITDKNTGRSKGYGFVTFRDPEAARRACVDPTPIIDGR 92


>At5g53680.1 68418.m06668 RNA recognition motif (RRM)-containing
           protein low similarity to RRM-containing protein SEB-4
           [Xenopus laevis] GI:8895698; contains InterPro entry
           IPR000504: RNA-binding region RNP-1 (RNA recognition
           motif) (RRM)
          Length = 169

 Score = 48.8 bits (111), Expect = 4e-06
 Identities = 21/51 (41%), Positives = 30/51 (58%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQIK 658
           L  +F  FG I+ V+VV D+ET + +G+GFV F D +   R C   N  I+
Sbjct: 29  LINFFKRFGEIIHVNVVCDRETDRSQGYGFVTFKDAESATRACKDPNPTIE 79



 Score = 43.2 bits (97), Expect = 2e-04
 Identities = 22/60 (36%), Positives = 34/60 (56%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEIK 434
           +GEI+ V V+ D +T RS+G+GF+T+  A     A  +    I+GRI   K A    ++K
Sbjct: 36  FGEIIHVNVVCDRETDRSQGYGFVTFKDAESATRACKDPNPTIEGRITNCKLAFVGAKVK 95


>At3g26420.1 68416.m03295 glycine-rich RNA-binding protein similar
           to RNA-binding protein (RZ-1) GB:BAA12064 [Nicotiana
           sylvestris]; contains Pfam profile: PF00076 RNA
           recognition motif. (a.k.a. RRM, RBD, or RNP domain)
          Length = 245

 Score = 47.6 bits (108), Expect = 9e-06
 Identities = 20/49 (40%), Positives = 29/49 (59%)
 Frame = +2

Query: 500 RRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQN 646
           R LR+ F  +G++V   VV DK +G+ RGFGF+ FD+   +D      N
Sbjct: 21  RGLRDAFEKYGHLVEAKVVLDKFSGRSRGFGFITFDEKKAMDEAIAAMN 69



 Score = 39.9 bits (89), Expect = 0.002
 Identities = 20/58 (34%), Positives = 33/58 (56%), Gaps = 1/58 (1%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEA-QNNRPHKIDGRIVEPKRAVPRE 425
           +G +V+  V+ D  + RS+GFGFIT+ +   +DEA        +DGR +   +A P +
Sbjct: 30  YGHLVEAKVVLDKFSGRSRGFGFITFDEKKAMDEAIAAMNGMDLDGRTITVDKAQPHQ 87



 Score = 27.9 bits (59), Expect = 7.8
 Identities = 12/28 (42%), Positives = 20/28 (71%)
 Frame = +1

Query: 169 EEPEHTRKLFIGGLDYRTTDSSLKEFYE 252
           E+PE+  + FIGGL + T+D  L++ +E
Sbjct: 3   EDPEY--RCFIGGLAWTTSDRGLRDAFE 28


>At1g76460.1 68414.m08893 RNA recognition motif (RRM)-containing
           protein low similarity to RRM-containing protein SEB-4
           [Xenopus laevis] GI:8895698; contains Pfam profile:
           PF00076 RNA recognition motif. (a.k.a. RRM, RBD, or RNP
           domain)
          Length = 285

 Score = 47.2 bits (107), Expect = 1e-05
 Identities = 18/43 (41%), Positives = 27/43 (62%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVC 634
           LR++F  +G I+   V+ DK TG+ +G+GFV F D +   R C
Sbjct: 40  LRQHFEQYGEILEAVVIADKNTGRSKGYGFVTFRDPEAARRAC 82



 Score = 40.3 bits (90), Expect = 0.001
 Identities = 19/46 (41%), Positives = 27/46 (58%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGR 392
           +GEI++ VV+ D  T RSKG+GF+T+        A  +    IDGR
Sbjct: 47  YGEILEAVVIADKNTGRSKGYGFVTFRDPEAARRACADPTPIIDGR 92


>At4g24770.1 68417.m03546 31 kDa ribonucleoprotein, chloroplast,
           putative / RNA-binding protein RNP-T, putative /
           RNA-binding protein 1/2/3, putative / RNA-binding
           protein cp31, putative similar to SP|Q04836 31 kDa
           ribonucleoprotein, chloroplast precursor (RNA-binding
           protein RNP-T) (RNA-binding protein 1/2/3) (AtRBP33)
           (RNA-binding protein cp31) {Arabidopsis thaliana};
           contains InterPro entry IPR000504: RNA-binding region
           RNP-1 (RNA recognition motif) (RRM)
          Length = 329

 Score = 46.8 bits (106), Expect = 2e-05
 Identities = 20/41 (48%), Positives = 26/41 (63%)
 Frame = +2

Query: 503 RLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVD 625
           RL + FS  G +V   VV D+ETG+ RGFGFV   D D ++
Sbjct: 259 RLEQLFSEHGKVVEARVVYDRETGRSRGFGFVTMSDVDELN 299



 Score = 38.3 bits (85), Expect = 0.006
 Identities = 26/89 (29%), Positives = 47/89 (52%), Gaps = 5/89 (5%)
 Frame = +3

Query: 261 EIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEA-QNNRPHKIDGRIVEPKRAVPREEIKR 437
           EI +V+  ++  T +S+GFGF+T S     + A +    + ++GR++   +A PR    R
Sbjct: 177 EIAEVIYNRE--TDQSRGFGFVTMSSVDEAETAVEKFNRYDLNGRLLTVNKAAPRG--SR 232

Query: 438 PEASATVK----KLFVAGLKQDIEEEDLE 512
           PE +  V     +++V  L  D++   LE
Sbjct: 233 PERAPRVYEPAFRVYVGNLPWDVDNGRLE 261



 Score = 35.5 bits (78), Expect = 0.039
 Identities = 15/34 (44%), Positives = 24/34 (70%)
 Frame = +3

Query: 258 GEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEA 359
           G++V+  V+ D +T RS+GFGF+T S    ++EA
Sbjct: 268 GKVVEARVVYDRETGRSRGFGFVTMSDVDELNEA 301



 Score = 29.9 bits (64), Expect = 1.9
 Identities = 12/36 (33%), Positives = 18/36 (50%)
 Frame = +2

Query: 518 FSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVD 625
           F   G +    V+ ++ET + RGFGFV     D  +
Sbjct: 170 FEQAGTVEIAEVIYNRETDQSRGFGFVTMSSVDEAE 205


>At5g61030.1 68418.m07659 RNA-binding protein, putative similar to
           RNA-binding protein from [Solanum tuberosum]
           GI:15822705, [Nicotiana tabacum] GI:15822703, [Nicotiana
           sylvestris] GI:624925; contains InterPro entry
           IPR000504: RNA-binding region RNP-1 (RNA recognition
           motif) (RRM)
          Length = 309

 Score = 45.6 bits (103), Expect = 4e-05
 Identities = 18/33 (54%), Positives = 24/33 (72%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEF 604
           LRE F+ +G +V   V+ D+ETG+ RGFGFV F
Sbjct: 56  LREAFTKYGEVVDTRVILDRETGRSRGFGFVTF 88



 Score = 40.3 bits (90), Expect = 0.001
 Identities = 21/57 (36%), Positives = 33/57 (57%), Gaps = 1/57 (1%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEA-QNNRPHKIDGRIVEPKRAVPR 422
           +GE+VD  V+ D +T RS+GFGF+T++ +     A Q      + GR+V+   A  R
Sbjct: 63  YGEVVDTRVILDRETGRSRGFGFVTFTSSEAASSAIQALDGRDLHGRVVKVNYANDR 119



 Score = 27.9 bits (59), Expect = 7.8
 Identities = 13/25 (52%), Positives = 18/25 (72%), Gaps = 1/25 (4%)
 Frame = +1

Query: 190 KLFIGGLDYRTTDSSLKE-FYEHGE 261
           KLFIGG+ Y   + SL+E F ++GE
Sbjct: 41  KLFIGGMAYSMDEDSLREAFTKYGE 65


>At3g23830.2 68416.m02996 glycine-rich RNA-binding protein, putative
           similar to Glycine-rich RNA-binding protein 2,
           mitochondrial precursor (AtGRP2) (Swiss-Prot:Q9SVM8)
           [Arabidopsis thaliana]; contains Pfam profile: PF00076
           RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
          Length = 136

 Score = 45.6 bits (103), Expect = 4e-05
 Identities = 17/37 (45%), Positives = 26/37 (70%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYD 616
           L++ F++FG +   +V+ D+ETG+ RGFGFV F   D
Sbjct: 51  LKQAFTSFGEVTEATVIADRETGRSRGFGFVSFSCED 87



 Score = 39.5 bits (88), Expect = 0.002
 Identities = 17/53 (32%), Positives = 35/53 (66%)
 Frame = +3

Query: 234 IKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGR 392
           +K+   ++GE+ +  V+ D +T RS+GFGF+++S     +++ NN   ++DG+
Sbjct: 51  LKQAFTSFGEVTEATVIADRETGRSRGFGFVSFS----CEDSANNAIKEMDGK 99



 Score = 30.7 bits (66), Expect = 1.1
 Identities = 15/25 (60%), Positives = 18/25 (72%), Gaps = 1/25 (4%)
 Frame = +1

Query: 190 KLFIGGLDYRTTDSSLKE-FYEHGE 261
           KLF+GGL + T DSSLK+ F   GE
Sbjct: 36  KLFVGGLSWGTDDSSLKQAFTSFGE 60


>At3g23830.1 68416.m02995 glycine-rich RNA-binding protein, putative
           similar to Glycine-rich RNA-binding protein 2,
           mitochondrial precursor (AtGRP2) (Swiss-Prot:Q9SVM8)
           [Arabidopsis thaliana]; contains Pfam profile: PF00076
           RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
          Length = 136

 Score = 45.6 bits (103), Expect = 4e-05
 Identities = 17/37 (45%), Positives = 26/37 (70%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYD 616
           L++ F++FG +   +V+ D+ETG+ RGFGFV F   D
Sbjct: 51  LKQAFTSFGEVTEATVIADRETGRSRGFGFVSFSCED 87



 Score = 39.5 bits (88), Expect = 0.002
 Identities = 17/53 (32%), Positives = 35/53 (66%)
 Frame = +3

Query: 234 IKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGR 392
           +K+   ++GE+ +  V+ D +T RS+GFGF+++S     +++ NN   ++DG+
Sbjct: 51  LKQAFTSFGEVTEATVIADRETGRSRGFGFVSFS----CEDSANNAIKEMDGK 99



 Score = 30.7 bits (66), Expect = 1.1
 Identities = 15/25 (60%), Positives = 18/25 (72%), Gaps = 1/25 (4%)
 Frame = +1

Query: 190 KLFIGGLDYRTTDSSLKE-FYEHGE 261
           KLF+GGL + T DSSLK+ F   GE
Sbjct: 36  KLFVGGLSWGTDDSSLKQAFTSFGE 60


>At5g50250.1 68418.m06223 31 kDa ribonucleoprotein, chloroplast,
           putative / RNA-binding protein RNP-T, putative /
           RNA-binding protein 1/2/3, putative / RNA-binding
           protein cp31, putative similar to SP|Q04836 31 kDa
           ribonucleoprotein, chloroplast precursor (RNA-binding
           protein RNP-T) (1/2/3) (AtRBP33) (cp31) {Arabidopsis
           thaliana}; contains InterPro entry IPR000504:
           RNA-binding region RNP-1 (RNA recognition motif) (RRM)
          Length = 289

 Score = 45.2 bits (102), Expect = 5e-05
 Identities = 19/41 (46%), Positives = 27/41 (65%)
 Frame = +2

Query: 503 RLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVD 625
           RL   FS  G +V   VV+D+ETG+ RGFGFV+  + + V+
Sbjct: 222 RLERLFSEHGKVVDARVVSDRETGRSRGFGFVQMSNENEVN 262



 Score = 40.3 bits (90), Expect = 0.001
 Identities = 25/87 (28%), Positives = 45/87 (51%), Gaps = 3/87 (3%)
 Frame = +3

Query: 261 EIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEA-QNNRPHKIDGRIVEPKRAVPR--EEI 431
           EI +V+  +D  T +S+GFGF+T S     ++A +     +++GR +   RA PR     
Sbjct: 140 EISEVIYNRD--TDQSRGFGFVTMSTVEEAEKAVEKFNSFEVNGRRLTVNRAAPRGSRPE 197

Query: 432 KRPEASATVKKLFVAGLKQDIEEEDLE 512
           ++P       +++V  L  D++   LE
Sbjct: 198 RQPRVYDAAFRIYVGNLPWDVDSGRLE 224



 Score = 35.5 bits (78), Expect = 0.039
 Identities = 16/42 (38%), Positives = 27/42 (64%)
 Frame = +3

Query: 234 IKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEA 359
           ++R+    G++VD  V+ D +T RS+GFGF+  S  + V+ A
Sbjct: 223 LERLFSEHGKVVDARVVSDRETGRSRGFGFVQMSNENEVNVA 264


>At4g13860.1 68417.m02147 glycine-rich RNA-binding protein, putative
           similar to Glycine-rich RNA-binding protein 2,
           mitochondrial precursor (AtGRP2) (Swiss-Prot:Q9SVM8)
           [Arabidopsis thaliana] ; contains InterPro entry
           IPR000504: RNA-binding region RNP-1 (RNA recognition
           motif) (RRM)
          Length = 87

 Score = 45.2 bits (102), Expect = 5e-05
 Identities = 22/52 (42%), Positives = 32/52 (61%), Gaps = 1/52 (1%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHK-IDGRIVEPK 407
           +G +VD +VM+D  T RS+GFGF+TYS     + A +    K ++GR V  K
Sbjct: 26  YGNVVDAIVMRDRYTDRSRGFGFVTYSSHSEAEAAVSGMDGKELNGRRVSVK 77



 Score = 41.9 bits (94), Expect = 4e-04
 Identities = 17/40 (42%), Positives = 25/40 (62%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVD 625
           LRE FS +GN+V   V+ D+ T + RGFGFV +  +   +
Sbjct: 19  LREAFSGYGNVVDAIVMRDRYTDRSRGFGFVTYSSHSEAE 58


>At1g74230.1 68414.m08597 glycine-rich RNA-binding protein similar
           to RNA-binding protein GB:S46286 from [Nicotiana
           sylvestris]
          Length = 289

 Score = 44.8 bits (101), Expect = 6e-05
 Identities = 17/33 (51%), Positives = 23/33 (69%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEF 604
           LRE FS +G +V   ++ D+ETG+ RGF FV F
Sbjct: 50  LREAFSKYGEVVDAKIIVDRETGRSRGFAFVTF 82



 Score = 38.7 bits (86), Expect = 0.004
 Identities = 18/65 (27%), Positives = 31/65 (47%)
 Frame = +3

Query: 228 FFIKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPK 407
           F ++     +GE+VD  ++ D +T RS+GF F+T++       A       + GR +   
Sbjct: 48  FGLREAFSKYGEVVDAKIIVDRETGRSRGFAFVTFTSTEEASNAMQLDGQDLHGRRIRVN 107

Query: 408 RAVPR 422
            A  R
Sbjct: 108 YATER 112


>At1g18630.1 68414.m02322 glycine-rich RNA-binding protein, putative
           similar to glycine-rich RNA-binding protein from
           {Sorghum bicolor} SP|Q99070, GI:1778373 from [Pisum
           sativum]; contains InterPro entry IPR000504: RNA-binding
           region RNP-1 (RNA recognition motif) (RRM)
          Length = 155

 Score = 44.8 bits (101), Expect = 6e-05
 Identities = 21/56 (37%), Positives = 35/56 (62%), Gaps = 1/56 (1%)
 Frame = +3

Query: 234 IKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHK-IDGRIV 398
           +K    ++G+IVD VV+ D ++  S+GFGF+TY    + + A     +K +DGRI+
Sbjct: 52  LKEAFGSFGKIVDAVVVLDRESGLSRGFGFVTYDSIEVANNAMQAMQNKELDGRII 107



 Score = 44.8 bits (101), Expect = 6e-05
 Identities = 19/37 (51%), Positives = 25/37 (67%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYD 616
           L+E F +FG IV   VV D+E+G  RGFGFV +D  +
Sbjct: 52  LKEAFGSFGKIVDAVVVLDRESGLSRGFGFVTYDSIE 88


>At4g39260.4 68417.m05560 glycine-rich RNA-binding protein 8 (GRP8)
           (CCR1) SP|Q03251 Glycine-rich RNA-binding protein 8
           (CCR1 protein) (GRP8) {Arabidopsis thaliana} isoform
           contains a non-consensus CG acceptor splice site at
           intron 2
          Length = 105

 Score = 44.4 bits (100), Expect = 8e-05
 Identities = 16/35 (45%), Positives = 25/35 (71%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDD 610
           L+  FS FG+++   ++ D+E+G+ RGFGFV F D
Sbjct: 22  LQRTFSQFGDVIDSKIINDRESGRSRGFGFVTFKD 56



 Score = 34.3 bits (75), Expect = 0.090
 Identities = 12/42 (28%), Positives = 27/42 (64%)
 Frame = +3

Query: 234 IKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEA 359
           ++R    +G+++D  ++ D ++ RS+GFGF+T+     + +A
Sbjct: 22  LQRTFSQFGDVIDSKIINDRESGRSRGFGFVTFKDEKAMRDA 63


>At4g39260.3 68417.m05559 glycine-rich RNA-binding protein 8 (GRP8)
           (CCR1) SP|Q03251 Glycine-rich RNA-binding protein 8
           (CCR1 protein) (GRP8) {Arabidopsis thaliana} isoform
           contains a non-consensus CG acceptor splice site at
           intron 2
          Length = 92

 Score = 44.4 bits (100), Expect = 8e-05
 Identities = 16/35 (45%), Positives = 25/35 (71%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDD 610
           L+  FS FG+++   ++ D+E+G+ RGFGFV F D
Sbjct: 22  LQRTFSQFGDVIDSKIINDRESGRSRGFGFVTFKD 56



 Score = 41.5 bits (93), Expect = 6e-04
 Identities = 18/64 (28%), Positives = 37/64 (57%), Gaps = 1/64 (1%)
 Frame = +3

Query: 234 IKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITY-SQAHMVDEAQNNRPHKIDGRIVEPKR 410
           ++R    +G+++D  ++ D ++ RS+GFGF+T+  +  M D  +     ++DGR++    
Sbjct: 22  LQRTFSQFGDVIDSKIINDRESGRSRGFGFVTFKDEKAMRDAIEEMNGKELDGRVITVNE 81

Query: 411 AVPR 422
           A  R
Sbjct: 82  AQSR 85


>At4g39260.2 68417.m05558 glycine-rich RNA-binding protein 8 (GRP8)
           (CCR1) SP|Q03251 Glycine-rich RNA-binding protein 8
           (CCR1 protein) (GRP8) {Arabidopsis thaliana} isoform
           contains a non-consensus CG acceptor splice site at
           intron 2
          Length = 126

 Score = 44.4 bits (100), Expect = 8e-05
 Identities = 16/35 (45%), Positives = 25/35 (71%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDD 610
           L+  FS FG+++   ++ D+E+G+ RGFGFV F D
Sbjct: 22  LQRTFSQFGDVIDSKIINDRESGRSRGFGFVTFKD 56



 Score = 41.5 bits (93), Expect = 6e-04
 Identities = 18/64 (28%), Positives = 37/64 (57%), Gaps = 1/64 (1%)
 Frame = +3

Query: 234 IKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITY-SQAHMVDEAQNNRPHKIDGRIVEPKR 410
           ++R    +G+++D  ++ D ++ RS+GFGF+T+  +  M D  +     ++DGR++    
Sbjct: 22  LQRTFSQFGDVIDSKIINDRESGRSRGFGFVTFKDEKAMRDAIEEMNGKELDGRVITVNE 81

Query: 411 AVPR 422
           A  R
Sbjct: 82  AQSR 85


>At4g39260.1 68417.m05557 glycine-rich RNA-binding protein 8 (GRP8)
           (CCR1) SP|Q03251 Glycine-rich RNA-binding protein 8
           (CCR1 protein) (GRP8) {Arabidopsis thaliana} isoform
           contains a non-consensus CG acceptor splice site at
           intron 2
          Length = 169

 Score = 44.4 bits (100), Expect = 8e-05
 Identities = 16/35 (45%), Positives = 25/35 (71%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDD 610
           L+  FS FG+++   ++ D+E+G+ RGFGFV F D
Sbjct: 22  LQRTFSQFGDVIDSKIINDRESGRSRGFGFVTFKD 56



 Score = 41.5 bits (93), Expect = 6e-04
 Identities = 18/64 (28%), Positives = 37/64 (57%), Gaps = 1/64 (1%)
 Frame = +3

Query: 234 IKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITY-SQAHMVDEAQNNRPHKIDGRIVEPKR 410
           ++R    +G+++D  ++ D ++ RS+GFGF+T+  +  M D  +     ++DGR++    
Sbjct: 22  LQRTFSQFGDVIDSKIINDRESGRSRGFGFVTFKDEKAMRDAIEEMNGKELDGRVITVNE 81

Query: 411 AVPR 422
           A  R
Sbjct: 82  AQSR 85


>At2g37510.1 68415.m04600 RNA-binding protein, putative similar to
           SP|P10979 Glycine-rich RNA-binding, abscisic
           acid-inducible protein {Zea mays}; contains InterPro
           entry IPR000504: RNA-binding region RNP-1 (RNA
           recognition motif) (RRM)
          Length = 142

 Score = 44.4 bits (100), Expect = 8e-05
 Identities = 15/48 (31%), Positives = 32/48 (66%)
 Frame = +2

Query: 503 RLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQN 646
           +L++ F++FG +V   V+TD+++G+ +GFGFV +   +  ++   + N
Sbjct: 49  KLQDAFASFGQLVDARVITDRDSGRSKGFGFVTYATIEDAEKAKAEMN 96



 Score = 43.6 bits (98), Expect = 1e-04
 Identities = 24/64 (37%), Positives = 39/64 (60%), Gaps = 1/64 (1%)
 Frame = +3

Query: 252 AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHK-IDGRIVEPKRAVPREE 428
           ++G++VD  V+ D  + RSKGFGF+TY+     ++A+     K +DG ++    A PRE 
Sbjct: 56  SFGQLVDARVITDRDSGRSKGFGFVTYATIEDAEKAKAEMNAKFLDGWVIFVDPARPREP 115

Query: 429 IKRP 440
            +RP
Sbjct: 116 -RRP 118


>At2g21660.2 68415.m02578 glycine-rich RNA-binding protein (GRP7)
           SP|Q03250 Glycine-rich RNA-binding protein 7
           {Arabidopsis thaliana}
          Length = 159

 Score = 44.4 bits (100), Expect = 8e-05
 Identities = 16/37 (43%), Positives = 25/37 (67%)
 Frame = +2

Query: 500 RRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDD 610
           R L   F+ +G+++   ++ D+ETG+ RGFGFV F D
Sbjct: 22  RALETAFAQYGDVIDSKIINDRETGRSRGFGFVTFKD 58



 Score = 40.7 bits (91), Expect = 0.001
 Identities = 18/57 (31%), Positives = 32/57 (56%), Gaps = 1/57 (1%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITY-SQAHMVDEAQNNRPHKIDGRIVEPKRAVPR 422
           +G+++D  ++ D +T RS+GFGF+T+  +  M D  +      +DGR +    A  R
Sbjct: 31  YGDVIDSKIINDRETGRSRGFGFVTFKDEKAMKDAIEGMNGQDLDGRSITVNEAQSR 87


>At2g21660.1 68415.m02577 glycine-rich RNA-binding protein (GRP7)
           SP|Q03250 Glycine-rich RNA-binding protein 7
           {Arabidopsis thaliana}
          Length = 176

 Score = 44.4 bits (100), Expect = 8e-05
 Identities = 16/37 (43%), Positives = 25/37 (67%)
 Frame = +2

Query: 500 RRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDD 610
           R L   F+ +G+++   ++ D+ETG+ RGFGFV F D
Sbjct: 22  RALETAFAQYGDVIDSKIINDRETGRSRGFGFVTFKD 58



 Score = 40.7 bits (91), Expect = 0.001
 Identities = 18/57 (31%), Positives = 32/57 (56%), Gaps = 1/57 (1%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITY-SQAHMVDEAQNNRPHKIDGRIVEPKRAVPR 422
           +G+++D  ++ D +T RS+GFGF+T+  +  M D  +      +DGR +    A  R
Sbjct: 31  YGDVIDSKIINDRETGRSRGFGFVTFKDEKAMKDAIEGMNGQDLDGRSITVNEAQSR 87


>At2g21690.1 68415.m02580 RNA-binding protein, putative similar to
           Glycine-rich RNA-binding protein from {Sinapis alba}
           SP|P49311, {Brassica napus} SP|Q05966, {Arabidopsis
           thaliana} SP|Q03251; contains InterPro entry IPR000504:
           RNA-binding region RNP-1 (RNA recognition motif) (RRM)
          Length = 117

 Score = 44.0 bits (99), Expect = 1e-04
 Identities = 16/35 (45%), Positives = 25/35 (71%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDD 610
           L + FS FGN++   ++ D++TGK R FGFV F++
Sbjct: 23  LTDIFSKFGNVIDSKIIYDRDTGKSRRFGFVTFEE 57



 Score = 29.5 bits (63), Expect = 2.6
 Identities = 10/35 (28%), Positives = 22/35 (62%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEA 359
           +G ++D  ++ D  T +S+ FGF+T+ +   + +A
Sbjct: 30  FGNVIDSKIIYDRDTGKSRRFGFVTFEEEKSMTDA 64


>At5g47320.1 68418.m05833 30S ribosomal protein S19, mitochondrial
           (RPS19)
          Length = 212

 Score = 43.6 bits (98), Expect = 1e-04
 Identities = 21/56 (37%), Positives = 31/56 (55%), Gaps = 1/56 (1%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQ-IKRFNI 670
           L++ FS+F  +    V+T+K TG+ RG+GFV F   D  +      N Q +  FNI
Sbjct: 47  LKDAFSSFNGVTEARVMTNKVTGRSRGYGFVNFISEDSANSAISAMNGQELNGFNI 102


>At3g06970.1 68416.m00828 RNA recognition motif (RRM)-containing
           protein contains Pfam profile: PF00076 RNA recognition
           motif. (a.k.a. RRM, RBD, or RNP domain)
          Length = 272

 Score = 43.6 bits (98), Expect = 1e-04
 Identities = 16/36 (44%), Positives = 24/36 (66%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDY 613
           LR YF  FG +V  +VV++   G+ +G+GF+ F DY
Sbjct: 28  LRRYFEQFGQVVDANVVSETYPGRSKGYGFITFRDY 63



 Score = 37.9 bits (84), Expect = 0.007
 Identities = 21/54 (38%), Positives = 32/54 (59%), Gaps = 1/54 (1%)
 Frame = +3

Query: 234 IKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITY-SQAHMVDEAQNNRPHKIDGR 392
           ++R    +G++VD  V+ +    RSKG+GFIT+      V   QN++P  IDGR
Sbjct: 28  LRRYFEQFGQVVDANVVSETYPGRSKGYGFITFRDYVSTVRALQNSKP-IIDGR 80


>At3g15010.2 68416.m01899 RNA recognition motif (RRM)-containing
           protein similar to UBP1 interacting protein 1a
           [Arabidopsis thaliana] GI:19574236; contains Pfam
           profile: PF00076 RNA recognition motif. (a.k.a. RRM,
           RBD, or RNP domain)
          Length = 404

 Score = 43.2 bits (97), Expect = 2e-04
 Identities = 23/93 (24%), Positives = 49/93 (52%), Gaps = 1/93 (1%)
 Frame = +3

Query: 234 IKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRA 413
           ++ +  ++G++ + +V+ D  T +SKG+GF+T+        A      KIDGR+   + A
Sbjct: 91  LRSLFSSYGDLEEAIVILDKVTGKSKGYGFVTFMHVDGALLALKEPSKKIDGRVTVTQLA 150

Query: 414 VPREEIKRPE-ASATVKKLFVAGLKQDIEEEDL 509
               +    + A  +++K++VA +  D+  + L
Sbjct: 151 ASGNQGTGSQIADISMRKIYVANVPFDMPADRL 183



 Score = 40.7 bits (91), Expect = 0.001
 Identities = 17/37 (45%), Positives = 24/37 (64%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYD 616
           LR  FS++G++    V+ DK TGK +G+GFV F   D
Sbjct: 91  LRSLFSSYGDLEEAIVILDKVTGKSKGYGFVTFMHVD 127



 Score = 27.9 bits (59), Expect = 7.8
 Identities = 12/29 (41%), Positives = 17/29 (58%)
 Frame = +2

Query: 503 RLREYFSTFGNIVSVSVVTDKETGKKRGF 589
           RL  +F  +G++    +  DK TGK RGF
Sbjct: 182 RLLNHFMAYGDVEEGPLGFDKVTGKSRGF 210



 Score = 27.9 bits (59), Expect = 7.8
 Identities = 17/63 (26%), Positives = 30/63 (47%)
 Frame = +3

Query: 252 AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEI 431
           A+G++ +  +  D  T +S+GF    Y  A     A  +    IDG+ +  K AV  ++ 
Sbjct: 189 AYGDVEEGPLGFDKVTGKSRGFALFVYKTAEGAQAALADPVKVIDGKHLNCKLAVDGKKG 248

Query: 432 KRP 440
            +P
Sbjct: 249 GKP 251


>At3g15010.1 68416.m01898 RNA recognition motif (RRM)-containing
           protein similar to UBP1 interacting protein 1a
           [Arabidopsis thaliana] GI:19574236; contains Pfam
           profile: PF00076 RNA recognition motif. (a.k.a. RRM,
           RBD, or RNP domain)
          Length = 404

 Score = 43.2 bits (97), Expect = 2e-04
 Identities = 23/93 (24%), Positives = 49/93 (52%), Gaps = 1/93 (1%)
 Frame = +3

Query: 234 IKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRA 413
           ++ +  ++G++ + +V+ D  T +SKG+GF+T+        A      KIDGR+   + A
Sbjct: 91  LRSLFSSYGDLEEAIVILDKVTGKSKGYGFVTFMHVDGALLALKEPSKKIDGRVTVTQLA 150

Query: 414 VPREEIKRPE-ASATVKKLFVAGLKQDIEEEDL 509
               +    + A  +++K++VA +  D+  + L
Sbjct: 151 ASGNQGTGSQIADISMRKIYVANVPFDMPADRL 183



 Score = 40.7 bits (91), Expect = 0.001
 Identities = 17/37 (45%), Positives = 24/37 (64%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYD 616
           LR  FS++G++    V+ DK TGK +G+GFV F   D
Sbjct: 91  LRSLFSSYGDLEEAIVILDKVTGKSKGYGFVTFMHVD 127



 Score = 27.9 bits (59), Expect = 7.8
 Identities = 12/29 (41%), Positives = 17/29 (58%)
 Frame = +2

Query: 503 RLREYFSTFGNIVSVSVVTDKETGKKRGF 589
           RL  +F  +G++    +  DK TGK RGF
Sbjct: 182 RLLNHFMAYGDVEEGPLGFDKVTGKSRGF 210



 Score = 27.9 bits (59), Expect = 7.8
 Identities = 17/63 (26%), Positives = 30/63 (47%)
 Frame = +3

Query: 252 AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEI 431
           A+G++ +  +  D  T +S+GF    Y  A     A  +    IDG+ +  K AV  ++ 
Sbjct: 189 AYGDVEEGPLGFDKVTGKSRGFALFVYKTAEGAQAALADPVKVIDGKHLNCKLAVDGKKG 248

Query: 432 KRP 440
            +P
Sbjct: 249 GKP 251


>At1g22910.3 68414.m02863 RNA recognition motif (RRM)-containing
           protein contains InterPro entry IPR000504: RNA-binding
           region RNP-1 (RNA recognition motif) (RRM); similar to
           GB:AAC33496
          Length = 347

 Score = 43.2 bits (97), Expect = 2e-04
 Identities = 21/57 (36%), Positives = 34/57 (59%)
 Frame = +3

Query: 222 HRFFIKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGR 392
           H+  +K+    +GEI++ VV+ D  + RSKG+GF+T+ +A     A  +    IDGR
Sbjct: 25  HKETMKKHFEQFGEILEAVVITDKASGRSKGYGFVTFREAEAARSACVDATPVIDGR 81



 Score = 43.2 bits (97), Expect = 2e-04
 Identities = 15/47 (31%), Positives = 29/47 (61%)
 Frame = +2

Query: 497 RRRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCL 637
           +  ++++F  FG I+   V+TDK +G+ +G+GFV F + +     C+
Sbjct: 26  KETMKKHFEQFGEILEAVVITDKASGRSKGYGFVTFREAEAARSACV 72


>At1g22910.2 68414.m02861 RNA recognition motif (RRM)-containing
           protein contains InterPro entry IPR000504: RNA-binding
           region RNP-1 (RNA recognition motif) (RRM); similar to
           GB:AAC33496
          Length = 242

 Score = 43.2 bits (97), Expect = 2e-04
 Identities = 21/57 (36%), Positives = 34/57 (59%)
 Frame = +3

Query: 222 HRFFIKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGR 392
           H+  +K+    +GEI++ VV+ D  + RSKG+GF+T+ +A     A  +    IDGR
Sbjct: 25  HKETMKKHFEQFGEILEAVVITDKASGRSKGYGFVTFREAEAARSACVDATPVIDGR 81



 Score = 43.2 bits (97), Expect = 2e-04
 Identities = 15/47 (31%), Positives = 29/47 (61%)
 Frame = +2

Query: 497 RRRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCL 637
           +  ++++F  FG I+   V+TDK +G+ +G+GFV F + +     C+
Sbjct: 26  KETMKKHFEQFGEILEAVVITDKASGRSKGYGFVTFREAEAARSACV 72


>At1g22910.1 68414.m02862 RNA recognition motif (RRM)-containing
           protein contains InterPro entry IPR000504: RNA-binding
           region RNP-1 (RNA recognition motif) (RRM); similar to
           GB:AAC33496
          Length = 249

 Score = 43.2 bits (97), Expect = 2e-04
 Identities = 21/57 (36%), Positives = 34/57 (59%)
 Frame = +3

Query: 222 HRFFIKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGR 392
           H+  +K+    +GEI++ VV+ D  + RSKG+GF+T+ +A     A  +    IDGR
Sbjct: 25  HKETMKKHFEQFGEILEAVVITDKASGRSKGYGFVTFREAEAARSACVDATPVIDGR 81



 Score = 43.2 bits (97), Expect = 2e-04
 Identities = 15/47 (31%), Positives = 29/47 (61%)
 Frame = +2

Query: 497 RRRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCL 637
           +  ++++F  FG I+   V+TDK +G+ +G+GFV F + +     C+
Sbjct: 26  KETMKKHFEQFGEILEAVVITDKASGRSKGYGFVTFREAEAARSACV 72


>At5g04280.1 68418.m00421 glycine-rich RNA-binding protein
          Length = 310

 Score = 42.7 bits (96), Expect = 3e-04
 Identities = 17/42 (40%), Positives = 27/42 (64%)
 Frame = +2

Query: 500 RRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVD 625
           R L   FS FG+I+   ++ +++TG+ RGFGF+ F D   +D
Sbjct: 21  RDLERAFSRFGDILDCQIMLERDTGRSRGFGFITFADRRAMD 62



 Score = 41.9 bits (94), Expect = 4e-04
 Identities = 20/64 (31%), Positives = 36/64 (56%), Gaps = 1/64 (1%)
 Frame = +3

Query: 234 IKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEA-QNNRPHKIDGRIVEPKR 410
           ++R    +G+I+D  +M +  T RS+GFGFIT++    +DE+ +         R++   R
Sbjct: 23  LERAFSRFGDILDCQIMLERDTGRSRGFGFITFADRRAMDESIREMHGRDFGDRVISVNR 82

Query: 411 AVPR 422
           A P+
Sbjct: 83  AEPK 86


>At1g71800.1 68414.m08298 cleavage stimulation factor, putative
           similar to cleavage stimulation factor 64 kilodalton
           subunit GB:AAD47839 GI:5713194 from [Drosophila
           melanogaster], SP|P33240 Cleavage stimulation factor, 64
           kDa subunit {Homo sapiens}; contains InterPro entry
           IPR000504: RNA-binding region RNP-1 (RNA recognition
           motif) (RRM)
          Length = 461

 Score = 42.7 bits (96), Expect = 3e-04
 Identities = 18/36 (50%), Positives = 25/36 (69%)
 Frame = +2

Query: 503 RLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDD 610
           +LRE     G +VS  +VTD+ETGK +G+GF E+ D
Sbjct: 24  QLREICGEVGPVVSFRLVTDRETGKPKGYGFCEYKD 59


>At3g08000.1 68416.m00977 RNA-binding protein, putative similar to
           RNA-binding protein from [Nicotiana tabacum]
           GI:15822703, [Nicotiana sylvestris] GI:624925; contains
           Pfam profile: PF00076 RNA recognition motif. (a.k.a.
           RRM, RBD, or RNP domain)
          Length = 143

 Score = 42.3 bits (95), Expect = 3e-04
 Identities = 16/33 (48%), Positives = 24/33 (72%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEF 604
           L++ FS+FG +  V +  DK +G+ RGFGFV+F
Sbjct: 57  LKDAFSSFGEVAEVRIAYDKGSGRSRGFGFVDF 89



 Score = 29.9 bits (64), Expect = 1.9
 Identities = 10/29 (34%), Positives = 21/29 (72%)
 Frame = +3

Query: 252 AWGEIVDVVVMKDPKTKRSKGFGFITYSQ 338
           ++GE+ +V +  D  + RS+GFGF+ +++
Sbjct: 63  SFGEVAEVRIAYDKGSGRSRGFGFVDFAE 91


>At2g36660.1 68415.m04496 polyadenylate-binding protein, putative /
           PABP, putative 
          Length = 609

 Score = 42.3 bits (95), Expect = 3e-04
 Identities = 20/37 (54%), Positives = 25/37 (67%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYD 616
           L++ F  FGNIVS  V T  E GK RG+GFV+F+  D
Sbjct: 128 LQDMFKKFGNIVSCKVAT-LEDGKSRGYGFVQFEQED 163



 Score = 35.1 bits (77), Expect = 0.052
 Identities = 18/41 (43%), Positives = 25/41 (60%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDR 628
           LRE F+ FG IVS+++  D E    RG+ FV FD+ +   R
Sbjct: 217 LREKFAEFGKIVSLAIAKD-ENRLCRGYAFVNFDNPEDARR 256



 Score = 34.7 bits (76), Expect = 0.068
 Identities = 17/33 (51%), Positives = 22/33 (66%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEF 604
           LR++FS  G I S  ++ D E GK +GFGFV F
Sbjct: 320 LRKHFSQCGTITSTKLMCD-EKGKSKGFGFVCF 351


>At3g46020.1 68416.m04979 RNA-binding protein, putative similar to
           Cold-inducible RNA-binding protein (Glycine-rich
           RNA-binding protein CIRP) from {Homo sapiens} SP|Q14011,
           {Rattus norvegicus} SP|Q61413,{Xenopus laevis};
           SP|O93235; contains InterPro entry IPR000504:
           RNA-binding region RNP-1 (RNA recognition motif) (RRM)
          Length = 102

 Score = 41.9 bits (94), Expect = 4e-04
 Identities = 17/37 (45%), Positives = 23/37 (62%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYD 616
           LR+ FS FG I    ++ D ET + +GFGF+ FD  D
Sbjct: 23  LRQLFSPFGQIKEARLIRDSETQRPKGFGFITFDSED 59



 Score = 41.1 bits (92), Expect = 8e-04
 Identities = 21/68 (30%), Positives = 41/68 (60%), Gaps = 1/68 (1%)
 Frame = +3

Query: 234 IKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKI-DGRIVEPKR 410
           ++++   +G+I +  +++D +T+R KGFGFIT+       +A  +   KI DGR++  + 
Sbjct: 23  LRQLFSPFGQIKEARLIRDSETQRPKGFGFITFDSEDDARKALKSLDGKIVDGRLIFVEV 82

Query: 411 AVPREEIK 434
           A   EE++
Sbjct: 83  AKNAEEVR 90


>At3g54770.1 68416.m06060 RNA recognition motif (RRM)-containing
           protein low similarity to RRM-containing protein SEB-4
           [Xenopus laevis] GI:8895698; contains InterPro entry
           IPR000504: RNA-binding region RNP-1 (RNA recognition
           motif) (RRM)
          Length = 261

 Score = 41.5 bits (93), Expect = 6e-04
 Identities = 17/46 (36%), Positives = 29/46 (63%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGR 392
           +G+I++ V++ D  T+RSKG+GF+T+  A     A  +    I+GR
Sbjct: 40  YGDILEAVIISDKLTRRSKGYGFVTFKDAKAATRACEDSTPIINGR 85



 Score = 39.1 bits (87), Expect = 0.003
 Identities = 14/46 (30%), Positives = 27/46 (58%)
 Frame = +2

Query: 497 RRRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVC 634
           +  + ++F  +G+I+   +++DK T + +G+GFV F D     R C
Sbjct: 30  KEAMYDHFIKYGDILEAVIISDKLTRRSKGYGFVTFKDAKAATRAC 75


>At2g37220.1 68415.m04566 29 kDa ribonucleoprotein, chloroplast,
           putative / RNA-binding protein cp29, putative similar to
           SP|Q43349 29 kDa ribonucleoprotein, chloroplast
           precursor (RNA-binding protein cp29) {Arabidopsis
           thaliana}
          Length = 289

 Score = 41.5 bits (93), Expect = 6e-04
 Identities = 19/48 (39%), Positives = 26/48 (54%)
 Frame = +2

Query: 503 RLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQN 646
           +L + F + GN+  V V+ DK TG+ RGFGFV       V+    Q N
Sbjct: 106 QLAQLFESAGNVEMVEVIYDKITGRSRGFGFVTMSSVSEVEAAAQQFN 153



 Score = 37.9 bits (84), Expect = 0.007
 Identities = 15/39 (38%), Positives = 23/39 (58%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPV 622
           L   FS  G +V   V+ D+++G+ +GFGFV +D    V
Sbjct: 220 LESLFSEQGKVVEARVIYDRDSGRSKGFGFVTYDSSQEV 258



 Score = 37.1 bits (82), Expect = 0.013
 Identities = 20/56 (35%), Positives = 31/56 (55%), Gaps = 1/56 (1%)
 Frame = +3

Query: 258 GEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEA-QNNRPHKIDGRIVEPKRAVPR 422
           G++V+  V+ D  + RSKGFGF+TY  +  V  A ++     +DGR +    A  R
Sbjct: 228 GKVVEARVIYDRDSGRSKGFGFVTYDSSQEVQNAIKSLDGADLDGRQIRVSEAEAR 283



 Score = 35.1 bits (77), Expect = 0.052
 Identities = 19/46 (41%), Positives = 27/46 (58%), Gaps = 1/46 (2%)
 Frame = +3

Query: 258 GEIVDVVVMKDPKTKRSKGFGFITYSQAHMVD-EAQNNRPHKIDGR 392
           G +  V V+ D  T RS+GFGF+T S    V+  AQ    +++DGR
Sbjct: 115 GNVEMVEVIYDKITGRSRGFGFVTMSSVSEVEAAAQQFNGYELDGR 160


>At5g04600.1 68418.m00460 RNA recognition motif (RRM)-containing
           protein contains InterPro entry IPR000504: RNA-binding
           region RNP-1 (RNA recognition motif) (RRM)
          Length = 222

 Score = 40.7 bits (91), Expect = 0.001
 Identities = 15/35 (42%), Positives = 24/35 (68%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDD 610
           +  +FS FG +  V V  +K+TGK + FGF++F+D
Sbjct: 76  IEAFFSQFGTVKRVRVARNKKTGKSKHFGFIQFED 110


>At4g16280.3 68417.m02471 flowering time control protein / FCA gamma
           (FCA) identical to SP|O04425 Flowering time control
           protein FCA {Arabidopsis thaliana}; four alternative
           splice variants, one splicing isoform contains a
           non-consensus CA donor splice site, based on cDNA:
           gi:2204090
          Length = 533

 Score = 40.3 bits (90), Expect = 0.001
 Identities = 17/50 (34%), Positives = 30/50 (60%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           +R YF   GN++ V+++ DK TG+++G  FV++      DR     ++QI
Sbjct: 136 IRPYFEQHGNVLEVALIKDKRTGQQQGCCFVKYATSKDADRAIRALHNQI 185



 Score = 29.5 bits (63), Expect = 2.6
 Identities = 22/73 (30%), Positives = 36/73 (49%), Gaps = 9/73 (12%)
 Frame = +3

Query: 234 IKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQN--NRPHKIDG------ 389
           ++ I   +G + DV +M+D + ++S+G GF+ YS       A +  N  + + G      
Sbjct: 227 VEEIFLQFGHVEDVYLMRD-EYRQSRGCGFVKYSSKETAMAAIDGLNGTYTMRGCNQPLI 285

Query: 390 -RIVEPKRAVPRE 425
            R  EPKR  P E
Sbjct: 286 VRFAEPKRPKPGE 298


>At4g16280.2 68417.m02470 flowering time control protein / FCA gamma
           (FCA) identical to SP|O04425 Flowering time control
           protein FCA {Arabidopsis thaliana}; four alternative
           splice variants, one splicing isoform contains a
           non-consensus CA donor splice site, based on cDNA:
           gi:2204090
          Length = 747

 Score = 40.3 bits (90), Expect = 0.001
 Identities = 17/50 (34%), Positives = 30/50 (60%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           +R YF   GN++ V+++ DK TG+++G  FV++      DR     ++QI
Sbjct: 136 IRPYFEQHGNVLEVALIKDKRTGQQQGCCFVKYATSKDADRAIRALHNQI 185



 Score = 29.5 bits (63), Expect = 2.6
 Identities = 22/73 (30%), Positives = 36/73 (49%), Gaps = 9/73 (12%)
 Frame = +3

Query: 234 IKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQN--NRPHKIDG------ 389
           ++ I   +G + DV +M+D + ++S+G GF+ YS       A +  N  + + G      
Sbjct: 227 VEEIFLQFGHVEDVYLMRD-EYRQSRGCGFVKYSSKETAMAAIDGLNGTYTMRGCNQPLI 285

Query: 390 -RIVEPKRAVPRE 425
            R  EPKR  P E
Sbjct: 286 VRFAEPKRPKPGE 298


>At3g53460.2 68416.m05901 29 kDa ribonucleoprotein, chloroplast /
           RNA-binding protein cp 29 nearly identical to SP|Q43349
           29 kDa ribonucleoprotein, chloroplast precursor
           (RNA-binding protein cp29) {Arabidopsis thaliana}
          Length = 334

 Score = 40.3 bits (90), Expect = 0.001
 Identities = 19/48 (39%), Positives = 26/48 (54%)
 Frame = +2

Query: 503 RLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQN 646
           +L + F + GN+  V V+ DK TG+ RGFGFV       V+    Q N
Sbjct: 114 QLAQLFESAGNVEMVEVIYDKVTGRSRGFGFVTMSTAAEVEAAAQQFN 161



 Score = 38.7 bits (86), Expect = 0.004
 Identities = 21/56 (37%), Positives = 32/56 (57%), Gaps = 1/56 (1%)
 Frame = +3

Query: 258 GEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNN-RPHKIDGRIVEPKRAVPR 422
           G++V+  V+ D  + RSKGFGF+T S +  V +A N+     +DGR +    A  R
Sbjct: 273 GKVVEARVIYDRDSGRSKGFGFVTLSSSQEVQKAINSLNGADLDGRQIRVSEAEAR 328



 Score = 33.9 bits (74), Expect = 0.12
 Identities = 19/46 (41%), Positives = 27/46 (58%), Gaps = 1/46 (2%)
 Frame = +3

Query: 258 GEIVDVVVMKDPKTKRSKGFGFITYSQAHMVD-EAQNNRPHKIDGR 392
           G +  V V+ D  T RS+GFGF+T S A  V+  AQ    ++ +GR
Sbjct: 123 GNVEMVEVIYDKVTGRSRGFGFVTMSTAAEVEAAAQQFNGYEFEGR 168



 Score = 33.9 bits (74), Expect = 0.12
 Identities = 13/41 (31%), Positives = 22/41 (53%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDR 628
           L   F+  G +V   V+ D+++G+ +GFGFV       V +
Sbjct: 265 LENLFNEQGKVVEARVIYDRDSGRSKGFGFVTLSSSQEVQK 305


>At3g53460.1 68416.m05900 29 kDa ribonucleoprotein, chloroplast /
           RNA-binding protein cp 29 nearly identical to SP|Q43349
           29 kDa ribonucleoprotein, chloroplast precursor
           (RNA-binding protein cp29) {Arabidopsis thaliana}
          Length = 342

 Score = 40.3 bits (90), Expect = 0.001
 Identities = 19/48 (39%), Positives = 26/48 (54%)
 Frame = +2

Query: 503 RLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQN 646
           +L + F + GN+  V V+ DK TG+ RGFGFV       V+    Q N
Sbjct: 114 QLAQLFESAGNVEMVEVIYDKVTGRSRGFGFVTMSTAAEVEAAAQQFN 161



 Score = 38.7 bits (86), Expect = 0.004
 Identities = 21/56 (37%), Positives = 32/56 (57%), Gaps = 1/56 (1%)
 Frame = +3

Query: 258 GEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNN-RPHKIDGRIVEPKRAVPR 422
           G++V+  V+ D  + RSKGFGF+T S +  V +A N+     +DGR +    A  R
Sbjct: 281 GKVVEARVIYDRDSGRSKGFGFVTLSSSQEVQKAINSLNGADLDGRQIRVSEAEAR 336



 Score = 33.9 bits (74), Expect = 0.12
 Identities = 19/46 (41%), Positives = 27/46 (58%), Gaps = 1/46 (2%)
 Frame = +3

Query: 258 GEIVDVVVMKDPKTKRSKGFGFITYSQAHMVD-EAQNNRPHKIDGR 392
           G +  V V+ D  T RS+GFGF+T S A  V+  AQ    ++ +GR
Sbjct: 123 GNVEMVEVIYDKVTGRSRGFGFVTMSTAAEVEAAAQQFNGYEFEGR 168



 Score = 33.9 bits (74), Expect = 0.12
 Identities = 13/41 (31%), Positives = 22/41 (53%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDR 628
           L   F+  G +V   V+ D+++G+ +GFGFV       V +
Sbjct: 273 LENLFNEQGKVVEARVIYDRDSGRSKGFGFVTLSSSQEVQK 313


>At3g47120.1 68416.m05116 RNA recognition motif (RRM)-containing
           protein contains InterPro entry IPR000504: RNA-binding
           region RNP-1 (RNA recognition motif) (RRM)
          Length = 352

 Score = 40.3 bits (90), Expect = 0.001
 Identities = 15/31 (48%), Positives = 23/31 (74%)
 Frame = +2

Query: 518 FSTFGNIVSVSVVTDKETGKKRGFGFVEFDD 610
           FS +G IV V+++ DK TGK +GF F+ ++D
Sbjct: 56  FSQYGEIVDVNLIRDKGTGKSKGFAFLAYED 86



 Score = 35.1 bits (77), Expect = 0.052
 Identities = 16/38 (42%), Positives = 23/38 (60%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNN 368
           +GEIVDV +++D  T +SKGF F+ Y        A +N
Sbjct: 59  YGEIVDVNLIRDKGTGKSKGFAFLAYEDQRSTILAVDN 96


>At2g22100.1 68415.m02625 RNA recognition motif (RRM)-containing
           protein similar to UBP1 interacting protein 1a
           [Arabidopsis thaliana] GI:19574236; contains Pfam
           profile: PF00076 RNA recognition motif (aka RRM, RBD, or
           RNP domain)
          Length = 382

 Score = 40.3 bits (90), Expect = 0.001
 Identities = 17/33 (51%), Positives = 22/33 (66%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEF 604
           L+  F  +G I   SVV DK+TG+ +GFGFV F
Sbjct: 179 LKAAFEVYGEITECSVVMDKDTGRAKGFGFVLF 211



 Score = 33.9 bits (74), Expect = 0.12
 Identities = 22/78 (28%), Positives = 33/78 (42%)
 Frame = +3

Query: 234 IKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRA 413
           +K     +GEI +  V+ D  T R+KGFGF+ +        A  N   ++  R V    A
Sbjct: 179 LKAAFEVYGEITECSVVMDKDTGRAKGFGFVLFKTRKGARAALKNPEKRMYNRTVSCLPA 238

Query: 414 VPREEIKRPEASATVKKL 467
            P    K  E    V+ +
Sbjct: 239 RPFNSGKPREQQQPVESV 256


>At1g48920.1 68414.m05480 nucleolin, putative similar to nuM1
           protein GI:1279562 from [Medicago sativa]
          Length = 557

 Score = 40.3 bits (90), Expect = 0.001
 Identities = 16/38 (42%), Positives = 26/38 (68%)
 Frame = +2

Query: 497 RRRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDD 610
           +  LRE+FS+ G I +VSV  D++TG  +G  ++EF +
Sbjct: 418 KNTLREHFSSCGEIKNVSVPIDRDTGNSKGIAYLEFSE 455



 Score = 32.7 bits (71), Expect = 0.28
 Identities = 14/36 (38%), Positives = 20/36 (55%)
 Frame = +2

Query: 497 RRRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEF 604
           R  +  +F   G +V V   T+++ G  RGFG VEF
Sbjct: 310 RADVENFFKEAGEVVDVRFSTNRDDGSFRGFGHVEF 345


>At1g47490.2 68414.m05269 RNA-binding protein 47 (RBP47), putative
           similar to DNA binding protein GI:1899187 from
           [Nicotiana tabacum]
          Length = 310

 Score = 40.3 bits (90), Expect = 0.001
 Identities = 17/37 (45%), Positives = 24/37 (64%)
 Frame = +2

Query: 536 IVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQN 646
           IVSV V+ +K  G   G+GFVEF+ +D  D+V  + N
Sbjct: 129 IVSVKVIRNKNNGLSEGYGFVEFESHDVADKVLREFN 165



 Score = 33.9 bits (74), Expect = 0.12
 Identities = 16/48 (33%), Positives = 26/48 (54%), Gaps = 1/48 (2%)
 Frame = +2

Query: 506 LREYFST-FGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQN 646
           L E FS  + ++ +  VV D  TG+ +G+GFV F D +   +   + N
Sbjct: 213 LHETFSEKYPSVKAAKVVLDANTGRSKGYGFVRFGDENERTKAMTEMN 260


>At1g47490.1 68414.m05270 RNA-binding protein 47 (RBP47), putative
           similar to DNA binding protein GI:1899187 from
           [Nicotiana tabacum]
          Length = 432

 Score = 40.3 bits (90), Expect = 0.001
 Identities = 17/37 (45%), Positives = 24/37 (64%)
 Frame = +2

Query: 536 IVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQN 646
           IVSV V+ +K  G   G+GFVEF+ +D  D+V  + N
Sbjct: 129 IVSVKVIRNKNNGLSEGYGFVEFESHDVADKVLREFN 165



 Score = 33.9 bits (74), Expect = 0.12
 Identities = 16/48 (33%), Positives = 26/48 (54%), Gaps = 1/48 (2%)
 Frame = +2

Query: 506 LREYFST-FGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQN 646
           L E FS  + ++ +  VV D  TG+ +G+GFV F D +   +   + N
Sbjct: 213 LHETFSEKYPSVKAAKVVLDANTGRSKGYGFVRFGDENERTKAMTEMN 260



 Score = 31.1 bits (67), Expect = 0.84
 Identities = 25/93 (26%), Positives = 38/93 (40%), Gaps = 15/93 (16%)
 Frame = +3

Query: 279 VMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPH-KIDGRIVEPKRAVPREE--------- 428
           V+ D  T RSKG+GF+ +   +   +A       K   R +    A PR+          
Sbjct: 229 VVLDANTGRSKGYGFVRFGDENERTKAMTEMNGVKCSSRAMRIGPATPRKTNGYQQQGGY 288

Query: 429 -----IKRPEASATVKKLFVAGLKQDIEEEDLE 512
                + RPE       +FV GL   + +EDL+
Sbjct: 289 MPNGTLTRPEGDIMNTTIFVGGLDSSVTDEDLK 321



 Score = 28.3 bits (60), Expect = 5.9
 Identities = 13/24 (54%), Positives = 16/24 (66%), Gaps = 1/24 (4%)
 Frame = +1

Query: 193 LFIGGLDYRTTDSSLKE-FYEHGE 261
           +F+GGLD   TD  LK+ F E GE
Sbjct: 306 IFVGGLDSSVTDEDLKQPFNEFGE 329


>At2g23350.1 68415.m02788 polyadenylate-binding protein, putative /
           PABP, putative
          Length = 662

 Score = 39.9 bits (89), Expect = 0.002
 Identities = 21/52 (40%), Positives = 28/52 (53%)
 Frame = +2

Query: 500 RRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           + L E FS  G IVS  V TD   G+ RG+GFV+FD  D       + N ++
Sbjct: 148 KTLHEAFSGCGTIVSCKVATD-HMGQSRGYGFVQFDTEDSAKNAIEKLNGKV 198



 Score = 35.9 bits (79), Expect = 0.030
 Identities = 19/48 (39%), Positives = 25/48 (52%)
 Frame = +2

Query: 503 RLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQN 646
           +LRE F+ FG I S  V+ D  +G  +G GFV F       RV  + N
Sbjct: 343 KLRELFAEFGTITSCKVMRD-PSGTSKGSGFVAFSAASEASRVLNEMN 389



 Score = 33.5 bits (73), Expect = 0.16
 Identities = 14/49 (28%), Positives = 26/49 (53%)
 Frame = +2

Query: 503 RLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNH 649
           +L +YF+    +VSV V  D  T    G+G+V + + D  ++   + N+
Sbjct: 61  QLYDYFTEVCQVVSVRVCRDAATNTSLGYGYVNYSNTDDAEKAMQKLNY 109



 Score = 29.5 bits (63), Expect = 2.6
 Identities = 20/78 (25%), Positives = 34/78 (43%)
 Frame = +3

Query: 234 IKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRA 413
           ++ +   +G I    VM+DP +  SKG GF+ +S A       N    K+ G        
Sbjct: 344 LRELFAEFGTITSCKVMRDP-SGTSKGSGFVAFSAASEASRVLNEMNGKMVGGKPLYVAL 402

Query: 414 VPREEIKRPEASATVKKL 467
             R+E +R +  A   ++
Sbjct: 403 AQRKEERRAKLQAQFSQM 420


>At1g47500.1 68414.m05272 RNA-binding protein 47 (RBP47), putative
           similar to DNA binding protein GI:1899187 from
           [Nicotiana tabacum]
          Length = 434

 Score = 39.9 bits (89), Expect = 0.002
 Identities = 16/37 (43%), Positives = 24/37 (64%)
 Frame = +2

Query: 536 IVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQN 646
           IVS+ V+ +K  G   G+GFVEF+ +D  D+V  + N
Sbjct: 131 IVSLKVIRNKHNGSSEGYGFVEFESHDVADKVLQEFN 167



 Score = 33.9 bits (74), Expect = 0.12
 Identities = 16/48 (33%), Positives = 26/48 (54%), Gaps = 1/48 (2%)
 Frame = +2

Query: 506 LREYFST-FGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQN 646
           L E FS  + ++ +  VV D  TG+ +G+GFV F D +   +   + N
Sbjct: 215 LHETFSEKYPSVKAAKVVLDANTGRSKGYGFVRFGDENERTKAMTEMN 262



 Score = 28.3 bits (60), Expect = 5.9
 Identities = 13/24 (54%), Positives = 16/24 (66%), Gaps = 1/24 (4%)
 Frame = +1

Query: 193 LFIGGLDYRTTDSSLKE-FYEHGE 261
           +F+GGLD   TD  LK+ F E GE
Sbjct: 308 IFVGGLDSSVTDEDLKQPFSEFGE 331


>At1g01080.1 68414.m00010 33 kDa ribonucleoprotein, chloroplast,
           putative / RNA-binding protein cp33, putative similar to
           33 KDA RIBONUCLEOPROTEIN GB:P19684 from [Nicotiana
           sylvestris]
          Length = 293

 Score = 39.9 bits (89), Expect = 0.002
 Identities = 17/33 (51%), Positives = 23/33 (69%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEF 604
           LR +FS FG IVS  V+ D++TG+ R F F+ F
Sbjct: 228 LRNHFSKFGTIVSTRVLHDRKTGRNRVFAFLSF 260



 Score = 33.1 bits (72), Expect = 0.21
 Identities = 13/32 (40%), Positives = 21/32 (65%)
 Frame = +2

Query: 503 RLREYFSTFGNIVSVSVVTDKETGKKRGFGFV 598
           +L + F  FG ++SV V  + +TG+ RG G+V
Sbjct: 123 QLLDMFQPFGTVISVEVSRNPQTGESRGSGYV 154



 Score = 31.5 bits (68), Expect = 0.64
 Identities = 19/64 (29%), Positives = 34/64 (53%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEIK 434
           +G IV   V+ D KT R++ F F++++     D A +      +G   E +R + RE I+
Sbjct: 235 FGTIVSTRVLHDRKTGRNRVFAFLSFTSGEERDAALS-----FNGTQYEGRRIIVREGIE 289

Query: 435 RPEA 446
           + E+
Sbjct: 290 KSES 293


>At3g18610.1 68416.m02365 nucleolin, putative contains Pfam profile:
           PF00076 RNA recognition motif
          Length = 636

 Score = 39.5 bits (88), Expect = 0.002
 Identities = 15/35 (42%), Positives = 23/35 (65%)
 Frame = +2

Query: 497 RRRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVE 601
           ++ LR +FS  G +  V V TD+ETG  RGF +++
Sbjct: 496 KKELRSHFSKCGEVTRVHVPTDRETGASRGFAYID 530


>At5g19350.1 68418.m02306 RNA-binding protein 45 (RBP45), putative
          Length = 425

 Score = 39.1 bits (87), Expect = 0.003
 Identities = 18/47 (38%), Positives = 26/47 (55%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQN 646
           L   FS  G +VSV V+ +K TG+  G+GF+EF  +   +R     N
Sbjct: 40  LTSCFSQTGELVSVKVIRNKITGQPEGYGFIEFISHAAAERTLQTYN 86



 Score = 35.1 bits (77), Expect = 0.052
 Identities = 16/48 (33%), Positives = 27/48 (56%), Gaps = 1/48 (2%)
 Frame = +2

Query: 506 LREYFST-FGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQN 646
           L+E F   + ++    VVTD  TG+ +G+GFV+F +    +R   + N
Sbjct: 132 LQETFRVHYSSVRGAKVVTDPSTGRSKGYGFVKFAEESERNRAMAEMN 179



 Score = 29.5 bits (63), Expect = 2.6
 Identities = 10/20 (50%), Positives = 16/20 (80%)
 Frame = +3

Query: 279 VMKDPKTKRSKGFGFITYSQ 338
           V+ DP T RSKG+GF+ +++
Sbjct: 148 VVTDPSTGRSKGYGFVKFAE 167


>At5g06210.1 68418.m00693 RNA-binding protein, putative contains
           similarity to RNA-binding protein from [Nicotiana
           tabacum] GI:15822703, [Nicotiana sylvestris] GI:624925,
           [Solanum tuberosum] GI:15822705; contains InterPro entry
           IPR000504: RNA-binding region RNP-1 (RNA recognition
           motif) (RRM)
          Length = 146

 Score = 39.1 bits (87), Expect = 0.003
 Identities = 17/49 (34%), Positives = 26/49 (53%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQ 652
           L E FS  G +V   +V D+ + + +GFGFV F   D   +  ++ N Q
Sbjct: 50  LSEAFSKCGQVVEAQIVMDRVSDRSKGFGFVTFASADEAQKALMEFNGQ 98



 Score = 35.9 bits (79), Expect = 0.030
 Identities = 16/35 (45%), Positives = 25/35 (71%)
 Frame = +3

Query: 258 GEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQ 362
           G++V+  ++ D  + RSKGFGF+T++ A   DEAQ
Sbjct: 58  GQVVEAQIVMDRVSDRSKGFGFVTFASA---DEAQ 89


>At4g20030.1 68417.m02932 RNA recognition motif (RRM)-containing
           protein low similarity to heterogeneous nuclear
           ribonucleoprotein G [Mus musculus] GI:5579009; contains
           InterPro entry IPR000504: RNA-binding region RNP-1 (RNA
           recognition motif) (RRM)
          Length = 152

 Score = 39.1 bits (87), Expect = 0.003
 Identities = 22/59 (37%), Positives = 36/59 (61%), Gaps = 3/59 (5%)
 Frame = +3

Query: 231 FIKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYS---QAHMVDEAQNNRPHKIDGRIV 398
           F+KR   A+GEI +V ++KD   KRSKG+ FI ++    A +  E  + R +  +GR++
Sbjct: 55  FLKREFSAFGEIAEVKLIKDEAMKRSKGYAFIQFTSQDDAFLAIETMDRRMY--NGRMI 111


>At2g19380.1 68415.m02260 RNA recognition motif (RRM)-containing
           protein similar to UBP1 interacting protein 1a
           [Arabidopsis thaliana] GI:19574236; contains InterPro
           entry IPR000504: RNA-binding region RNP-1 (RNA
           recognition motif) (RRM); contains Pfam profile PF00096:
           Zinc finger, C2H2 type
          Length = 613

 Score = 39.1 bits (87), Expect = 0.003
 Identities = 16/36 (44%), Positives = 24/36 (66%)
 Frame = +2

Query: 497 RRRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEF 604
           +  L+  F ++G I   SVV DK+TG+ +G+GFV F
Sbjct: 421 QENLKTAFESYGEIEECSVVMDKDTGRGKGYGFVMF 456



 Score = 32.7 bits (71), Expect = 0.28
 Identities = 17/55 (30%), Positives = 27/55 (49%)
 Frame = +3

Query: 234 IKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIV 398
           +K    ++GEI +  V+ D  T R KG+GF+ +       EA      ++  RIV
Sbjct: 424 LKTAFESYGEIEECSVVMDKDTGRGKGYGFVMFKTRKGAREALKRPEKRMYNRIV 478


>At2g16260.1 68415.m01862 glycine-rich RNA-binding protein, putative
           similar to Glycine-rich RNA-binding protein from {Daucus
           carota} SP|Q03878, {Sinapis alba} SP|P49311, {Brassica
           napus} SP|Q05966, {Arabidopsis thaliana} SP|Q03251;
           contains InterPro entry IPR000504: RNA-binding region
           RNP-1 (RNA recognition motif) (RRM)
          Length = 185

 Score = 39.1 bits (87), Expect = 0.003
 Identities = 16/45 (35%), Positives = 25/45 (55%)
 Frame = +2

Query: 518 FSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQ 652
           F+ FG +    ++ D+ETG+ +GF FV F D D +     + N Q
Sbjct: 64  FNEFGEVFDSKIIIDRETGRSKGFRFVTFKDEDSMRTAIDRMNGQ 108



 Score = 33.9 bits (74), Expect = 0.12
 Identities = 18/54 (33%), Positives = 29/54 (53%), Gaps = 1/54 (1%)
 Frame = +3

Query: 234 IKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEA-QNNRPHKIDGR 392
           I+R    +GE+ D  ++ D +T RSKGF F+T+     +  A       ++DGR
Sbjct: 60  IERCFNEFGEVFDSKIIIDRETGRSKGFRFVTFKDEDSMRTAIDRMNGQELDGR 113


>At5g51300.2 68418.m06360 splicing factor-related contains
           similarity to SF1 protein [Drosophila melanogaster]
           GI:6687400
          Length = 804

 Score = 38.7 bits (86), Expect = 0.004
 Identities = 15/31 (48%), Positives = 22/31 (70%)
 Frame = +2

Query: 518 FSTFGNIVSVSVVTDKETGKKRGFGFVEFDD 610
           FS+FG IV   V+ D+ TG  +G+GFV++ D
Sbjct: 500 FSSFGEIVMAKVIKDRVTGLSKGYGFVKYAD 530



 Score = 37.5 bits (83), Expect = 0.010
 Identities = 19/48 (39%), Positives = 29/48 (60%), Gaps = 1/48 (2%)
 Frame = +3

Query: 252 AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEA-QNNRPHKIDGR 392
           ++GEIV   V+KD  T  SKG+GF+ Y+   M + A Q    ++ +GR
Sbjct: 502 SFGEIVMAKVIKDRVTGLSKGYGFVKYADVQMANTAVQAMNGYRFEGR 549


>At5g51300.1 68418.m06359 splicing factor-related contains
           similarity to SF1 protein [Drosophila melanogaster]
           GI:6687400
          Length = 804

 Score = 38.7 bits (86), Expect = 0.004
 Identities = 15/31 (48%), Positives = 22/31 (70%)
 Frame = +2

Query: 518 FSTFGNIVSVSVVTDKETGKKRGFGFVEFDD 610
           FS+FG IV   V+ D+ TG  +G+GFV++ D
Sbjct: 500 FSSFGEIVMAKVIKDRVTGLSKGYGFVKYAD 530



 Score = 37.5 bits (83), Expect = 0.010
 Identities = 19/48 (39%), Positives = 29/48 (60%), Gaps = 1/48 (2%)
 Frame = +3

Query: 252 AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEA-QNNRPHKIDGR 392
           ++GEIV   V+KD  T  SKG+GF+ Y+   M + A Q    ++ +GR
Sbjct: 502 SFGEIVMAKVIKDRVTGLSKGYGFVKYADVQMANTAVQAMNGYRFEGR 549


>At3g11400.1 68416.m01390 eukaryotic translation initiation factor
           3G / eIF3g nearly identical to eukaryotic translation
           initiation factor 3g [Arabidopsis thaliana] GI:12407751
          Length = 294

 Score = 38.7 bits (86), Expect = 0.004
 Identities = 19/47 (40%), Positives = 24/47 (51%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQN 646
           L E F  FG +  V V  D++TG  RGFGFV F   +   R   + N
Sbjct: 229 LMELFHPFGAVTRVYVAIDQKTGVSRGFGFVNFVSREDAQRAINKLN 275



 Score = 29.9 bits (64), Expect = 1.9
 Identities = 18/57 (31%), Positives = 26/57 (45%), Gaps = 1/57 (1%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNN-RPHKIDGRIVEPKRAVPR 422
           +G +  V V  D KT  S+GFGF+ +        A N    +  D  I+  + A PR
Sbjct: 236 FGAVTRVYVAIDQKTGVSRGFGFVNFVSREDAQRAINKLNGYGYDNLILRVEWATPR 292


>At2g18510.1 68415.m02157 pre-mRNA splicing factor, putative similar
           to SP|Q15427 Splicing factor 3B subunit 4 (Spliceosome
           associated protein 49) (SAP 49) (SF3b50) (Pre-mRNA
           splicing factor SF3b 49 kDa subunit) {Homo sapiens};
           contains Pfam profile PF00076: RNA recognition motif.
           (a.k.a. RRM, RBD, or RNP domain)
          Length = 363

 Score = 38.7 bits (86), Expect = 0.004
 Identities = 17/41 (41%), Positives = 25/41 (60%), Gaps = 1/41 (2%)
 Frame = +2

Query: 506 LREYFSTFGNIVS-VSVVTDKETGKKRGFGFVEFDDYDPVD 625
           L + FS FG I S   ++ D +TG  RGFGF+ +D ++  D
Sbjct: 128 LYDTFSAFGVIASNPKIMRDPDTGNSRGFGFISYDSFEASD 168



 Score = 32.7 bits (71), Expect = 0.28
 Identities = 13/27 (48%), Positives = 17/27 (62%)
 Frame = +3

Query: 279 VMKDPKTKRSKGFGFITYSQAHMVDEA 359
           +M+DP T  S+GFGFI+Y      D A
Sbjct: 144 IMRDPDTGNSRGFGFISYDSFEASDAA 170


>At1g60650.2 68414.m06828 glycine-rich RNA-binding protein, putative
           similar to RNA binding protein(RZ-1) GI:1435061 from
           [Nicotiana sylvestris]; contains InterPro entry
           IPR000504: RNA-binding region RNP-1 (RNA recognition
           motif) (RRM)
          Length = 292

 Score = 38.7 bits (86), Expect = 0.004
 Identities = 14/37 (37%), Positives = 22/37 (59%)
 Frame = +2

Query: 500 RRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDD 610
           R+L   F  +G I    ++  ++TG+ RGFGF+ F D
Sbjct: 26  RQLESTFDRYGKITECQIMVGRDTGRPRGFGFITFTD 62



 Score = 34.7 bits (76), Expect = 0.068
 Identities = 15/57 (26%), Positives = 32/57 (56%), Gaps = 1/57 (1%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEA-QNNRPHKIDGRIVEPKRAVPR 422
           +G+I +  +M    T R +GFGFIT++     D+A ++    ++  +++   +A P+
Sbjct: 35  YGKITECQIMVGRDTGRPRGFGFITFTDRRGADDAIKHMHGRELGNKVISVNKAEPK 91


>At1g60650.1 68414.m06827 glycine-rich RNA-binding protein, putative
           similar to RNA binding protein(RZ-1) GI:1435061 from
           [Nicotiana sylvestris]; contains InterPro entry
           IPR000504: RNA-binding region RNP-1 (RNA recognition
           motif) (RRM)
          Length = 292

 Score = 38.7 bits (86), Expect = 0.004
 Identities = 14/37 (37%), Positives = 22/37 (59%)
 Frame = +2

Query: 500 RRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDD 610
           R+L   F  +G I    ++  ++TG+ RGFGF+ F D
Sbjct: 26  RQLESTFDRYGKITECQIMVGRDTGRPRGFGFITFTD 62



 Score = 34.7 bits (76), Expect = 0.068
 Identities = 15/57 (26%), Positives = 32/57 (56%), Gaps = 1/57 (1%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEA-QNNRPHKIDGRIVEPKRAVPR 422
           +G+I +  +M    T R +GFGFIT++     D+A ++    ++  +++   +A P+
Sbjct: 35  YGKITECQIMVGRDTGRPRGFGFITFTDRRGADDAIKHMHGRELGNKVISVNKAEPK 91


>At4g36690.3 68417.m05206 U2 snRNP auxiliary factor large subunit,
           putative similar to U2 snRNP auxiliary factor, large
           subunit [Nicotiana plumbaginifolia] GI:3850823
          Length = 565

 Score = 38.3 bits (85), Expect = 0.006
 Identities = 15/48 (31%), Positives = 24/48 (50%)
 Frame = +2

Query: 503 RLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQN 646
           ++RE   +FG +    +V D+ETG  +G+ F  + D    D  C   N
Sbjct: 374 QVRELLESFGGLKGFDLVKDRETGNSKGYAFCVYQDLSVTDIACAALN 421



 Score = 27.9 bits (59), Expect = 7.8
 Identities = 12/42 (28%), Positives = 23/42 (54%)
 Frame = +3

Query: 234 IKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEA 359
           ++ +L ++G +    ++KD +T  SKG+ F  Y    + D A
Sbjct: 375 VRELLESFGGLKGFDLVKDRETGNSKGYAFCVYQDLSVTDIA 416


>At4g36690.2 68417.m05207 U2 snRNP auxiliary factor large subunit,
           putative similar to U2 snRNP auxiliary factor, large
           subunit [Nicotiana plumbaginifolia] GI:3850823
          Length = 542

 Score = 38.3 bits (85), Expect = 0.006
 Identities = 15/48 (31%), Positives = 24/48 (50%)
 Frame = +2

Query: 503 RLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQN 646
           ++RE   +FG +    +V D+ETG  +G+ F  + D    D  C   N
Sbjct: 374 QVRELLESFGGLKGFDLVKDRETGNSKGYAFCVYQDLSVTDIACAALN 421



 Score = 27.9 bits (59), Expect = 7.8
 Identities = 12/42 (28%), Positives = 23/42 (54%)
 Frame = +3

Query: 234 IKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEA 359
           ++ +L ++G +    ++KD +T  SKG+ F  Y    + D A
Sbjct: 375 VRELLESFGGLKGFDLVKDRETGNSKGYAFCVYQDLSVTDIA 416


>At4g36690.1 68417.m05205 U2 snRNP auxiliary factor large subunit,
           putative similar to U2 snRNP auxiliary factor, large
           subunit [Nicotiana plumbaginifolia] GI:3850823
          Length = 573

 Score = 38.3 bits (85), Expect = 0.006
 Identities = 15/48 (31%), Positives = 24/48 (50%)
 Frame = +2

Query: 503 RLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQN 646
           ++RE   +FG +    +V D+ETG  +G+ F  + D    D  C   N
Sbjct: 374 QVRELLESFGGLKGFDLVKDRETGNSKGYAFCVYQDLSVTDIACAALN 421



 Score = 27.9 bits (59), Expect = 7.8
 Identities = 12/42 (28%), Positives = 23/42 (54%)
 Frame = +3

Query: 234 IKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEA 359
           ++ +L ++G +    ++KD +T  SKG+ F  Y    + D A
Sbjct: 375 VRELLESFGGLKGFDLVKDRETGNSKGYAFCVYQDLSVTDIA 416


>At1g11650.2 68414.m01337 RNA-binding protein 45 (RBP45), putative
           similar to gb|U90212 DNA binding protein ACBF from
           Nicotiana tabacum and contains 3 PF|00076 RNA
           recognition motif domains. ESTs gb|T44278, gb|R65195,
           gb|N65904, gb|H37499, gb|R90487, gb|N95952, gb|T44278,
           gb|Z20166, gb|N96891, gb|W43137, gb|F15504, gb|F1
          Length = 405

 Score = 38.3 bits (85), Expect = 0.006
 Identities = 15/38 (39%), Positives = 25/38 (65%)
 Frame = +2

Query: 518 FSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRV 631
           F+  G +VS  V+ +K+TG+  G+GF+EF  +   +RV
Sbjct: 82  FAHTGEMVSAKVIRNKQTGQVEGYGFIEFASHAAAERV 119



 Score = 34.3 bits (75), Expect = 0.090
 Identities = 14/47 (29%), Positives = 25/47 (53%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQN 646
           L  + +++ ++    VV D+ TG+ +G+GFV F D     R   + N
Sbjct: 172 LETFRASYPSVKGAKVVIDRVTGRTKGYGFVRFSDESEQIRAMTEMN 218



 Score = 27.9 bits (59), Expect = 7.8
 Identities = 14/31 (45%), Positives = 20/31 (64%), Gaps = 1/31 (3%)
 Frame = +1

Query: 172 EPEHTRKLFIGGLDYRTTDSSLKE-FYEHGE 261
           +P +T  +F+GGLD   TD  LK  F ++GE
Sbjct: 257 DPNNTT-VFVGGLDASVTDDHLKNVFSQYGE 286


>At1g11650.1 68414.m01336 RNA-binding protein 45 (RBP45), putative
           similar to gb|U90212 DNA binding protein ACBF from
           Nicotiana tabacum and contains 3 PF|00076 RNA
           recognition motif domains. ESTs gb|T44278, gb|R65195,
           gb|N65904, gb|H37499, gb|R90487, gb|N95952, gb|T44278,
           gb|Z20166, gb|N96891, gb|W43137, gb|F15504, gb|F1
          Length = 306

 Score = 38.3 bits (85), Expect = 0.006
 Identities = 15/38 (39%), Positives = 25/38 (65%)
 Frame = +2

Query: 518 FSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRV 631
           F+  G +VS  V+ +K+TG+  G+GF+EF  +   +RV
Sbjct: 82  FAHTGEMVSAKVIRNKQTGQVEGYGFIEFASHAAAERV 119



 Score = 34.3 bits (75), Expect = 0.090
 Identities = 14/47 (29%), Positives = 25/47 (53%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQN 646
           L  + +++ ++    VV D+ TG+ +G+GFV F D     R   + N
Sbjct: 172 LETFRASYPSVKGAKVVIDRVTGRTKGYGFVRFSDESEQIRAMTEMN 218



 Score = 27.9 bits (59), Expect = 7.8
 Identities = 14/31 (45%), Positives = 20/31 (64%), Gaps = 1/31 (3%)
 Frame = +1

Query: 172 EPEHTRKLFIGGLDYRTTDSSLKE-FYEHGE 261
           +P +T  +F+GGLD   TD  LK  F ++GE
Sbjct: 257 DPNNTT-VFVGGLDASVTDDHLKNVFSQYGE 286


>At5g54580.1 68418.m06794 RNA recognition motif (RRM)-containing
           protein low similarity to RNA-binding protein RGP-3
           [Nicotiana sylvestris] GI:1009363; contains InterPro
           entry IPR000504: RNA-binding region RNP-1 (RNA
           recognition motif) (RRM)
          Length = 156

 Score = 37.9 bits (84), Expect = 0.007
 Identities = 15/33 (45%), Positives = 21/33 (63%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEF 604
           LR  F+ FG +    VVTD+ +G  +GFGFV +
Sbjct: 72  LRTAFAQFGEVADAKVVTDRVSGYSKGFGFVRY 104



 Score = 33.9 bits (74), Expect = 0.12
 Identities = 19/59 (32%), Positives = 31/59 (52%), Gaps = 1/59 (1%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHK-IDGRIVEPKRAVPREE 428
           +GE+ D  V+ D  +  SKGFGF+ Y+      +       K +DG ++  + A PRE+
Sbjct: 79  FGEVADAKVVTDRVSGYSKGFGFVRYATLEDSAKGIAGMDGKFLDGWVIFAEYARPREQ 137


>At5g09880.1 68418.m01142 RNA recognition motif (RRM)-containing
           protein
          Length = 527

 Score = 37.9 bits (84), Expect = 0.007
 Identities = 15/34 (44%), Positives = 23/34 (67%)
 Frame = +2

Query: 503 RLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEF 604
           +LR+ F  FG +  V +  D ETG+ +GFGF++F
Sbjct: 280 QLRQIFEAFGPVELVQLPLDPETGQCKGFGFIQF 313



 Score = 32.7 bits (71), Expect = 0.28
 Identities = 12/37 (32%), Positives = 23/37 (62%)
 Frame = +2

Query: 500 RRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDD 610
           R + E+FS  G +  V ++ D+ + + +G G++EF D
Sbjct: 182 RDVYEFFSKAGKVRDVRLIMDRNSRRSKGVGYIEFYD 218



 Score = 31.9 bits (69), Expect = 0.48
 Identities = 20/58 (34%), Positives = 32/58 (55%), Gaps = 2/58 (3%)
 Frame = +3

Query: 234 IKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQ--NNRPHKIDGRIVE 401
           +++I  A+G +  V +  DP+T + KGFGFI + Q      AQ   N   +I GR ++
Sbjct: 281 LRQIFEAFGPVELVQLPLDPETGQCKGFGFIQFVQLEHSKAAQIALNGKLEIAGRTIK 338


>At4g19610.1 68417.m02881 RNA recognition motif (RRM)-containing
           protein contains InterPro entry IPR000504: RNA-binding
           region RNP-1 (RNA recognition motif) (RRM)
          Length = 783

 Score = 37.9 bits (84), Expect = 0.007
 Identities = 16/31 (51%), Positives = 21/31 (67%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFV 598
           L E+FSTFG I  V +V DKET + RG  ++
Sbjct: 277 LMEHFSTFGKISEVHLVLDKETKRSRGIAYI 307



 Score = 29.5 bits (63), Expect = 2.6
 Identities = 14/36 (38%), Positives = 21/36 (58%), Gaps = 2/36 (5%)
 Frame = +2

Query: 530 GNIVSVSVVTDKETGK--KRGFGFVEFDDYDPVDRV 631
           G I+SV+++  K+  K    G+GFVEFD  +    V
Sbjct: 596 GKILSVTIIKHKKNEKYLSSGYGFVEFDSVETATSV 631



 Score = 28.3 bits (60), Expect = 5.9
 Identities = 26/88 (29%), Positives = 44/88 (50%), Gaps = 5/88 (5%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITY----SQAHMVDEAQNNRPHKIDGRIVEPKRAVPR 422
           +G+I +V ++ D +TKRS+G  +I Y      A  ++E  N+      GR++    A  R
Sbjct: 284 FGKISEVHLVLDKETKRSRGIAYILYLIPECAARAMEELDNS---SFQGRLLHILPAKHR 340

Query: 423 E-EIKRPEASATVKKLFVAGLKQDIEEE 503
           E   K+   ++ + K F    KQ  EE+
Sbjct: 341 ETSDKQVNDTSNLPKTF----KQKREEQ 364


>At5g64200.2 68418.m08063 arginine/serine-rich splicing factor SC35
           contains similarity to splicing factor; contains Pfam
           profile PF00076: RNA recognition motif. (a.k.a. RRM,
           RBD, or RNP domain)
          Length = 303

 Score = 37.5 bits (83), Expect = 0.010
 Identities = 18/49 (36%), Positives = 31/49 (63%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVE 401
           +G++VDV + +D +T  S+GF F+ Y      DEA +    ++DGR+V+
Sbjct: 39  YGKVVDVFIPRDRRTGDSRGFAFVRYKYK---DEA-HKAVERLDGRVVD 83


>At5g64200.1 68418.m08062 arginine/serine-rich splicing factor SC35
           contains similarity to splicing factor; contains Pfam
           profile PF00076: RNA recognition motif. (a.k.a. RRM,
           RBD, or RNP domain)
          Length = 303

 Score = 37.5 bits (83), Expect = 0.010
 Identities = 18/49 (36%), Positives = 31/49 (63%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVE 401
           +G++VDV + +D +T  S+GF F+ Y      DEA +    ++DGR+V+
Sbjct: 39  YGKVVDVFIPRDRRTGDSRGFAFVRYKYK---DEA-HKAVERLDGRVVD 83


>At5g54900.1 68418.m06838 RNA-binding protein 45 (RBP45), putative
           contains similarity to polyadenylate-binding protein 5
          Length = 387

 Score = 37.5 bits (83), Expect = 0.010
 Identities = 15/44 (34%), Positives = 25/44 (56%)
 Frame = +2

Query: 521 STFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQ 652
           + +G++    VV D+ TG+ +G+GFV F D +   R   + N Q
Sbjct: 176 NVYGSVKGAKVVLDRTTGRSKGYGFVRFADENEQMRAMTEMNGQ 219



 Score = 35.5 bits (78), Expect = 0.039
 Identities = 15/43 (34%), Positives = 23/43 (53%)
 Frame = +2

Query: 518 FSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQN 646
           F+  G   S  V+ +K TG+  G+GF+EF  +   +RV    N
Sbjct: 80  FAQSGEATSAKVIRNKLTGQSEGYGFIEFVSHSVAERVLQTYN 122



 Score = 30.7 bits (66), Expect = 1.1
 Identities = 18/45 (40%), Positives = 27/45 (60%), Gaps = 1/45 (2%)
 Frame = +1

Query: 136 NMKPSESGDDYEEPEHTRKLFIGGLDYRTTDSSLKE-FYEHGEKL 267
           N + + +GD+  +P +T  +F+GGLD   TD  LK  F + GE L
Sbjct: 246 NTQGANAGDN--DPNNTT-IFVGGLDANVTDDELKSIFGQFGELL 287


>At2g22090.2 68415.m02624 UBP1 interacting protein 1a (UBA1a) nearly
           identical to UBP1 interacting protein 1a [Arabidopsis
           thaliana] GI:19574236; contains InterPro entry
           IPR000504: RNA-binding region RNP-1 (RNA recognition
           motif) (RRM); based on cDNA of partial mRNA for UBP1
           interacting protein 1a (uba1a) GI:19574235
          Length = 347

 Score = 37.5 bits (83), Expect = 0.010
 Identities = 18/36 (50%), Positives = 21/36 (58%)
 Frame = +2

Query: 497 RRRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEF 604
           R  L   F  +G I   +VV DK TGK +GFGFV F
Sbjct: 117 RETLVGVFEGYGEIEECTVVIDKATGKAKGFGFVMF 152



 Score = 30.3 bits (65), Expect = 1.5
 Identities = 15/46 (32%), Positives = 23/46 (50%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGR 392
           +GEI +  V+ D  T ++KGFGF+ +       EA      +I  R
Sbjct: 127 YGEIEECTVVIDKATGKAKGFGFVMFKTRKGAKEALKEPKKRILNR 172


>At2g22090.1 68415.m02623 UBP1 interacting protein 1a (UBA1a) nearly
           identical to UBP1 interacting protein 1a [Arabidopsis
           thaliana] GI:19574236; contains InterPro entry
           IPR000504: RNA-binding region RNP-1 (RNA recognition
           motif) (RRM); based on cDNA of partial mRNA for UBP1
           interacting protein 1a (uba1a) GI:19574235
          Length = 343

 Score = 37.5 bits (83), Expect = 0.010
 Identities = 18/36 (50%), Positives = 21/36 (58%)
 Frame = +2

Query: 497 RRRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEF 604
           R  L   F  +G I   +VV DK TGK +GFGFV F
Sbjct: 117 RETLVGVFEGYGEIEECTVVIDKATGKAKGFGFVMF 152



 Score = 30.3 bits (65), Expect = 1.5
 Identities = 15/46 (32%), Positives = 23/46 (50%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGR 392
           +GEI +  V+ D  T ++KGFGF+ +       EA      +I  R
Sbjct: 127 YGEIEECTVVIDKATGKAKGFGFVMFKTRKGAKEALKEPKKRILNR 172


>At1g49760.1 68414.m05580 polyadenylate-binding protein, putative /
           PABP, putative similar to poly(A)-binding protein
           GB:AAF66825 GI:7673359 from [Nicotiana tabacum]
          Length = 671

 Score = 37.5 bits (83), Expect = 0.010
 Identities = 19/48 (39%), Positives = 26/48 (54%)
 Frame = +2

Query: 503 RLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQN 646
           +LRE+F+ FG I S  V+ D  +G  RG GFV F   +   R   + N
Sbjct: 342 KLREHFAPFGTITSCKVMRD-PSGVSRGSGFVAFSTPEEATRAITEMN 388



 Score = 36.3 bits (80), Expect = 0.022
 Identities = 16/36 (44%), Positives = 24/36 (66%)
 Frame = +2

Query: 500 RRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFD 607
           + L E FS FG I+S  V  D  +G+ +G+GFV++D
Sbjct: 147 KALHETFSAFGPILSCKVAVDP-SGQSKGYGFVQYD 181



 Score = 35.1 bits (77), Expect = 0.052
 Identities = 21/85 (24%), Positives = 42/85 (49%), Gaps = 1/85 (1%)
 Frame = +3

Query: 258 GEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPH-KIDGRIVEPKRAVPREEIK 434
           G++V V V +D  T+RS G+G++ Y+       A N      ++GR +    +V    ++
Sbjct: 69  GQVVSVRVCRDMTTRRSLGYGYVNYATPQDASRALNELNFMALNGRAIRVMYSVRDPSLR 128

Query: 435 RPEASATVKKLFVAGLKQDIEEEDL 509
           +    + V  +F+  L + I+ + L
Sbjct: 129 K----SGVGNIFIKNLDKSIDHKAL 149



 Score = 34.3 bits (75), Expect = 0.090
 Identities = 17/41 (41%), Positives = 23/41 (56%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDR 628
           L + F  FG   S  ++ D E GK +GFGFV F++ D   R
Sbjct: 240 LNKVFGEFGVTTSCVIMRDGE-GKSKGFGFVNFENSDDAAR 279



 Score = 31.5 bits (68), Expect = 0.64
 Identities = 21/85 (24%), Positives = 41/85 (48%)
 Frame = +3

Query: 234 IKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRA 413
           + ++   +G     V+M+D + K SKGFGF+ +  +   D+A       ++G+  + K  
Sbjct: 240 LNKVFGEFGVTTSCVIMRDGEGK-SKGFGFVNFENS---DDAA-RAVDALNGKTFDDKEW 294

Query: 414 VPREEIKRPEASATVKKLFVAGLKQ 488
              +  K+ E    +K+ F   LK+
Sbjct: 295 FVGKAQKKSERETELKQKFEQSLKE 319



 Score = 29.5 bits (63), Expect = 2.6
 Identities = 13/34 (38%), Positives = 20/34 (58%)
 Frame = +2

Query: 503 RLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEF 604
           +L E F+  G +VSV V  D  T +  G+G+V +
Sbjct: 60  QLFEAFTQAGQVVSVRVCRDMTTRRSLGYGYVNY 93


>At4g34110.1 68417.m04839 polyadenylate-binding protein 2 (PABP2)
           non-consensus TA donor splice site at exon 2,
           polyadenylate-binding protein - Triticum aestivum
           (common wheat),PIR:T06979
          Length = 443

 Score = 37.1 bits (82), Expect = 0.013
 Identities = 18/41 (43%), Positives = 24/41 (58%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDR 628
           L+  F  +G I S  V+ D E GK +GFGFV F++ D   R
Sbjct: 45  LKNAFGEYGKITSAVVMKDGE-GKSKGFGFVNFENADDAAR 84



 Score = 35.5 bits (78), Expect = 0.039
 Identities = 23/66 (34%), Positives = 33/66 (50%), Gaps = 1/66 (1%)
 Frame = +3

Query: 234 IKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEA-QNNRPHKIDGRIVEPKR 410
           +K     +G+I   VVMKD + K SKGFGF+ +  A     A ++   HK D +     R
Sbjct: 45  LKNAFGEYGKITSAVVMKDGEGK-SKGFGFVNFENADDAARAVESLNGHKFDDKEWYVGR 103

Query: 411 AVPREE 428
           A  + E
Sbjct: 104 AQKKSE 109


>At3g52380.1 68416.m05757 33 kDa ribonucleoprotein, chloroplast,
           putative / RNA-binding protein cp33, putative similar to
           chloroplast RNA-binding protein (cp33) GB:BAA06523
           (Arabidopsis thaliana) (Plant Mol. Biol. 27 (3), 529-539
           (1995)); contains InterPro entry IPR000504: RNA-binding
           region RNP-1 (RNA recognition motif) (RRM)
          Length = 329

 Score = 37.1 bits (82), Expect = 0.013
 Identities = 20/49 (40%), Positives = 27/49 (55%), Gaps = 1/49 (2%)
 Frame = +3

Query: 258 GEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEA-QNNRPHKIDGRIVE 401
           G +VDV ++ D  T RS+GFGF+T        EA Q     +I GR V+
Sbjct: 140 GTVVDVQIVYDKVTDRSRGFGFVTMGSIEEAKEAMQMFNSSQIGGRTVK 188



 Score = 35.1 bits (77), Expect = 0.052
 Identities = 15/31 (48%), Positives = 19/31 (61%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFV 598
           L + F   G +V V +V DK T + RGFGFV
Sbjct: 132 LSQIFGEAGTVVDVQIVYDKVTDRSRGFGFV 162



 Score = 34.7 bits (76), Expect = 0.068
 Identities = 13/47 (27%), Positives = 24/47 (51%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQN 646
           L++ F     ++   V+ ++ TG+ RGFGF+ F+  + V       N
Sbjct: 235 LKDAFGDQPGVLGAKVIYERNTGRSRGFGFISFESAENVQSALATMN 281



 Score = 30.3 bits (65), Expect = 1.5
 Identities = 17/56 (30%), Positives = 29/56 (51%), Gaps = 1/56 (1%)
 Frame = +3

Query: 264 IVDVVVMKDPKTKRSKGFGFITYSQAHMVDEA-QNNRPHKIDGRIVEPKRAVPREE 428
           ++   V+ +  T RS+GFGFI++  A  V  A       +++GR +    A  RE+
Sbjct: 245 VLGAKVIYERNTGRSRGFGFISFESAENVQSALATMNGVEVEGRALRLNLASEREK 300


>At3g19130.1 68416.m02429 RNA-binding protein, putative similar to
           RNA Binding Protein 47 [Nicotiana plumbaginifolia]
           GI:9663769, DNA binding protein ACBF GB:AAC49850 from
           [Nicotiana tabacum]; contains InterPro entry IPR000504:
           RNA-binding region RNP-1 (RNA recognition motif) (RRM)
          Length = 435

 Score = 37.1 bits (82), Expect = 0.013
 Identities = 18/48 (37%), Positives = 26/48 (54%), Gaps = 1/48 (2%)
 Frame = +2

Query: 506 LREYFST-FGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQN 646
           L E FS  + ++ S  VV D  TG+ +G+GFV F D +   R   + N
Sbjct: 218 LHETFSDRYPSVKSAKVVIDSNTGRSKGYGFVRFGDENERSRALTEMN 265



 Score = 33.9 bits (74), Expect = 0.12
 Identities = 15/33 (45%), Positives = 20/33 (60%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEF 604
           L   FS  G + SV V+ +K T +  G+GFVEF
Sbjct: 124 LHSCFSHTGEVSSVKVIRNKLTSQSEGYGFVEF 156



 Score = 28.7 bits (61), Expect = 4.5
 Identities = 11/37 (29%), Positives = 21/37 (56%)
 Frame = +3

Query: 258 GEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNN 368
           GE+  V V+++  T +S+G+GF+ +      +E   N
Sbjct: 132 GEVSSVKVIRNKLTSQSEGYGFVEFLSRAAAEEVLQN 168



 Score = 28.3 bits (60), Expect = 5.9
 Identities = 16/35 (45%), Positives = 20/35 (57%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDD 610
           LR+ FS FG +VSV +   K      G GFV+F D
Sbjct: 337 LRQPFSQFGEVVSVKIPVGK------GCGFVQFAD 365



 Score = 25.0 bits (52), Expect(2) = 5.2
 Identities = 17/58 (29%), Positives = 28/58 (48%), Gaps = 8/58 (13%)
 Frame = +3

Query: 279 VMKDPKTKRSKGFGFITYSQAHMVDEAQ--------NNRPHKIDGRIVEPKRAVPREE 428
           V+ D  T RSKG+GF+ +   +    A         +NR  ++   I  PKRA+  ++
Sbjct: 234 VVIDSNTGRSKGYGFVRFGDENERSRALTEMNGAYCSNRQMRVG--IATPKRAIANQQ 289



 Score = 21.8 bits (44), Expect(2) = 5.2
 Identities = 8/23 (34%), Positives = 14/23 (60%)
 Frame = +3

Query: 441 EASATVKKLFVAGLKQDIEEEDL 509
           +  +T   +FV G+  D+ +EDL
Sbjct: 315 DGESTNATIFVGGIDPDVIDEDL 337


>At3g16380.1 68416.m02074 polyadenylate-binding protein, putative /
           PABP, putative similar to polyadenylate-binding protein
           (poly(A)-binding protein) from {Arabidopsis thaliana}
           SP|P42731, [Cucumis sativus] GI:7528270, {Homo sapiens}
           SP|Q13310, {Arabidopsis thaliana} SP|Q05196; contains
           InterPro entry IPR000504: RNA-binding region RNP-1 (RNA
           recognition motif) (RRM)
          Length = 537

 Score = 37.1 bits (82), Expect = 0.013
 Identities = 18/36 (50%), Positives = 23/36 (63%)
 Frame = +2

Query: 503 RLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDD 610
           RLRE F  +G IVS  V+   E G+ +GFGFV F +
Sbjct: 319 RLREIFGCYGQIVSAKVMC-HENGRSKGFGFVCFSN 353



 Score = 36.3 bits (80), Expect = 0.022
 Identities = 17/34 (50%), Positives = 23/34 (67%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFD 607
           L   F  FG+I+S  VV  +E G+ +GFGFV+FD
Sbjct: 128 LERMFCPFGSILSCKVV--EENGQSKGFGFVQFD 159



 Score = 32.3 bits (70), Expect = 0.36
 Identities = 16/33 (48%), Positives = 20/33 (60%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEF 604
           L   FS +G + SV V+ D   G+ RGFGFV F
Sbjct: 218 LHTLFSQYGTVSSVVVMRDG-MGRSRGFGFVNF 249



 Score = 32.3 bits (70), Expect = 0.36
 Identities = 23/85 (27%), Positives = 41/85 (48%)
 Frame = +3

Query: 234 IKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRA 413
           ++ I   +G+IV   VM   +  RSKGFGF+ +S      E        ++G +V+ K  
Sbjct: 320 LREIFGCYGQIVSAKVMCH-ENGRSKGFGFVCFSNC----EESKQAKRYLNGFLVDGKPI 374

Query: 414 VPREEIKRPEASATVKKLFVAGLKQ 488
           V R   ++ +    +++ F A  +Q
Sbjct: 375 VVRVAERKEDRIKRLQQYFQAQPRQ 399



 Score = 28.7 bits (61), Expect = 4.5
 Identities = 19/72 (26%), Positives = 35/72 (48%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEIK 434
           +G +  VVVM+D    RS+GFGF+ +       +A  +    + G  +  K+    + +K
Sbjct: 225 YGTVSSVVVMRDGMG-RSRGFGFVNFCNPENAKKAMES----LCGLQLGSKKLFVGKALK 279

Query: 435 RPEASATVKKLF 470
           + E    +K+ F
Sbjct: 280 KDERREMLKQKF 291


>At1g60900.1 68414.m06856 U2 snRNP auxiliary factor large subunit,
           putative similar to U2 snRNP auxiliary factor, large
           subunit GB:CAA77136 from [Nicotiana plumbaginifolia]
          Length = 589

 Score = 37.1 bits (82), Expect = 0.013
 Identities = 15/48 (31%), Positives = 25/48 (52%)
 Frame = +2

Query: 503 RLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQN 646
           ++RE   +FG +   ++V D+ETG  +G+ F  + D    D  C   N
Sbjct: 390 QIRELLESFGPLRGFNLVKDRETGNSKGYAFCVYQDPSVTDIACAALN 437



 Score = 28.3 bits (60), Expect = 5.9
 Identities = 13/42 (30%), Positives = 23/42 (54%)
 Frame = +3

Query: 234 IKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEA 359
           I+ +L ++G +    ++KD +T  SKG+ F  Y    + D A
Sbjct: 391 IRELLESFGPLRGFNLVKDRETGNSKGYAFCVYQDPSVTDIA 432


>At1g22760.1 68414.m02844 polyadenylate-binding protein 3 (PABP3)
          Length = 660

 Score = 37.1 bits (82), Expect = 0.013
 Identities = 17/36 (47%), Positives = 25/36 (69%)
 Frame = +2

Query: 500 RRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFD 607
           + L E FS+FG I+S  V  D  TG+ +G+GFV+F+
Sbjct: 150 KALFETFSSFGTILSCKVAMDV-TGRSKGYGFVQFE 184



 Score = 36.7 bits (81), Expect = 0.017
 Identities = 17/48 (35%), Positives = 28/48 (58%)
 Frame = +2

Query: 503 RLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQN 646
           +L+E FS +GN+ S  V+ + + G  RGFGFV + + +   R   + N
Sbjct: 347 KLKEMFSEYGNVTSSKVMLNPQ-GMSRGFGFVAYSNPEEALRALSEMN 393



 Score = 31.9 bits (69), Expect = 0.48
 Identities = 25/93 (26%), Positives = 49/93 (52%), Gaps = 7/93 (7%)
 Frame = +3

Query: 252 AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRA-----V 416
           ++G I+   V  D  T RSKG+GF+ + +    +E+      K++G ++  K+      +
Sbjct: 158 SFGTILSCKVAMDV-TGRSKGYGFVQFEK----EESAQAAIDKLNGMLMNDKQVFVGHFI 212

Query: 417 PREEIKRPEASATVK--KLFVAGLKQDIEEEDL 509
            R+E  R E + T +   ++V  L ++I E++L
Sbjct: 213 RRQERARDENTPTPRFTNVYVKNLPKEIGEDEL 245



 Score = 29.9 bits (64), Expect = 1.9
 Identities = 21/82 (25%), Positives = 35/82 (42%)
 Frame = +3

Query: 234 IKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRA 413
           +K +   +G +    VM +P+   S+GFGF+ YS       A +    K+ GR       
Sbjct: 348 LKEMFSEYGNVTSSKVMLNPQGM-SRGFGFVAYSNPEEALRALSEMNGKMIGRKPLYIAL 406

Query: 414 VPREEIKRPEASATVKKLFVAG 479
             R+E +R    A   ++   G
Sbjct: 407 AQRKEDRRAHLQALFSQIRAPG 428


>At3g55460.1 68416.m06159 SC35-like splicing factor, 30 kD (SCL30)
           nearly identical to SC35-like splicing factor SCL30, 30
           kD [Arabidopsis thaliana] GI:9843657;
           Serine/arginine-rich protein/putative splicing factor,
           Arabidopdis thaliana, EMBL:AF099940; contains Pfam
           profile PF00076: RNA recognition motif. (a.k.a. RRM,
           RBD, or RNP domain)
          Length = 262

 Score = 36.7 bits (81), Expect = 0.017
 Identities = 19/38 (50%), Positives = 23/38 (60%), Gaps = 1/38 (2%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEF-DDYD 616
           LRE F  FG +  V +  D  +G+ RGF FVEF D YD
Sbjct: 63  LREPFERFGPVRDVYIPRDYYSGQPRGFAFVEFVDAYD 100



 Score = 30.7 bits (66), Expect = 1.1
 Identities = 20/64 (31%), Positives = 32/64 (50%), Gaps = 1/64 (1%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHK-IDGRIVEPKRAVPREEI 431
           +G + DV + +D  + + +GF F+ +  A+   EAQ +   +   GR  E    V  E  
Sbjct: 70  FGPVRDVYIPRDYYSGQPRGFAFVEFVDAYDAGEAQRSMNRRSFAGR--EITVVVASESR 127

Query: 432 KRPE 443
           KRPE
Sbjct: 128 KRPE 131


>At3g20930.1 68416.m02645 RNA recognition motif (RRM)-containing
           protein contains Pfam profile: PF00076 RNA recognition
           motif
          Length = 374

 Score = 36.7 bits (81), Expect = 0.017
 Identities = 17/59 (28%), Positives = 30/59 (50%)
 Frame = +2

Query: 500 RRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQIKRFNIWM 676
           + LR  F  FG +V V ++ DK + + +G+ F+E+   +       + N +I   N WM
Sbjct: 296 KTLRAAFEGFGELVEVKIIMDKISKRSKGYAFLEYTTEEAAGTALKEMNGKI--INGWM 352



 Score = 35.1 bits (77), Expect = 0.052
 Identities = 16/48 (33%), Positives = 31/48 (64%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIV 398
           +GE+V+V ++ D  +KRSKG+ F+ Y+     +EA      +++G+I+
Sbjct: 305 FGELVEVKIIMDKISKRSKGYAFLEYT----TEEAAGTALKEMNGKII 348



 Score = 30.7 bits (66), Expect = 1.1
 Identities = 15/36 (41%), Positives = 22/36 (61%), Gaps = 1/36 (2%)
 Frame = +1

Query: 148 SESGDDYEEPE-HTRKLFIGGLDYRTTDSSLKEFYE 252
           S   DD E P   T+KLFI GL + T++ +L+  +E
Sbjct: 268 SRDQDDSESPPVKTKKLFITGLSFYTSEKTLRAAFE 303


>At1g55310.1 68414.m06318 SC35-like splicing factor, 33 kD (SCL33)
           nearly identical to SC35-like splicing factor SCL33, 33
           kD [Arabidopsis thaliana] GI:9843659
          Length = 220

 Score = 36.3 bits (80), Expect = 0.022
 Identities = 18/40 (45%), Positives = 23/40 (57%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVD 625
           LR+ F  FG +  + +  D  TG  RGFGFV+F   DP D
Sbjct: 52  LRKSFEQFGPVKDIYLPRDYYTGDPRGFGFVQF--MDPAD 89


>At1g34140.1 68414.m04235 polyadenylate-binding protein, putative /
           PABP, putative non-consensus splice donor TA at exon 1;
           similar to polyadenylate-binding protein
           (poly(A)-binding protein) from [Triticum aestivum]
           GI:1737492, [Nicotiana tabacum] GI:7673355, {Arabidopsis
           thaliana} SP|P42731; contains InterPro entry IPR000504:
           RNA-binding region RNP-1 (RNA recognition motif) (RRM)
          Length = 407

 Score = 36.3 bits (80), Expect = 0.022
 Identities = 22/58 (37%), Positives = 34/58 (58%)
 Frame = +3

Query: 234 IKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPK 407
           +KR+   +GEI   VVMKD + K S+ FGF+ + +A    EA      K++G +V+ K
Sbjct: 135 LKRLFGEFGEITSAVVMKDGEGK-SRRFGFVNFEKA----EAAVTAIEKMNGVVVDEK 187


>At1g07350.1 68414.m00783 transformer serine/arginine-rich
           ribonucleoprotein, putative similar to GB:Y09506 from
           [Nicotiana tabacum] (Plant Mol. Biol. 35 (3), 261-269
           (1997))
          Length = 382

 Score = 36.3 bits (80), Expect = 0.022
 Identities = 16/53 (30%), Positives = 30/53 (56%), Gaps = 1/53 (1%)
 Frame = +3

Query: 258 GEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKI-DGRIVEPKRA 413
           G++ DV ++ DP T+ S+GFGFI+       +    +  H +  GR++  ++A
Sbjct: 99  GKVTDVHLVLDPWTRESRGFGFISMKSVGDANRCIRSLDHSVLQGRVITVEKA 151



 Score = 34.7 bits (76), Expect = 0.068
 Identities = 15/52 (28%), Positives = 25/52 (48%)
 Frame = +2

Query: 500 RRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           R L ++F+  G +  V +V D  T + RGFGF+        +R     +H +
Sbjct: 89  RDLEDHFAKEGKVTDVHLVLDPWTRESRGFGFISMKSVGDANRCIRSLDHSV 140


>At4g27000.1 68417.m03884 RNA-binding protein 45 (RBP45), putative
           DNA binding protein ACBF - Nicotiana tabacum,
           PID:g1899188
          Length = 415

 Score = 35.5 bits (78), Expect = 0.039
 Identities = 17/50 (34%), Positives = 26/50 (52%), Gaps = 1/50 (2%)
 Frame = +2

Query: 506 LREYF-STFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQ 652
           L E F + + ++    VV D+ TG+ +G+GFV F D     R   + N Q
Sbjct: 189 LTETFKAVYSSVKGAKVVNDRTTGRSKGYGFVRFADESEQIRAMTEMNGQ 238



 Score = 31.5 bits (68), Expect = 0.64
 Identities = 12/41 (29%), Positives = 21/41 (51%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDR 628
           L   F   G   +  V+ +K+ G   G+GF+EF ++   +R
Sbjct: 96  LMNVFGLTGEATAAKVIRNKQNGYSEGYGFIEFVNHATAER 136


>At3g14100.1 68416.m01782 oligouridylate-binding protein, putative
           similar to GB:CAB75429 (GI:6996560) from [Nicotiana
           plumbaginifolia], contains Pfam profiles: PF00076 RNA
           recognition motif (3 copies)
          Length = 427

 Score = 35.5 bits (78), Expect = 0.039
 Identities = 15/33 (45%), Positives = 21/33 (63%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEF 604
           L + FS F +     V+ D++TG+ RGFGFV F
Sbjct: 160 LYQSFSVFSSCSDARVMWDQKTGRSRGFGFVSF 192



 Score = 30.3 bits (65), Expect = 1.5
 Identities = 14/32 (43%), Positives = 18/32 (56%)
 Frame = +3

Query: 270 DVVVMKDPKTKRSKGFGFITYSQAHMVDEAQN 365
           D  VM D KT RS+GFGF+++        A N
Sbjct: 172 DARVMWDQKTGRSRGFGFVSFRNQQDAQTAIN 203


>At3g13570.1 68416.m01707 SC35-like splicing factor, 30a kD (SCL30a)
           almost identical to SC35-like splicing factor SCL30a
           GI:9843661 from [Arabidopsis thaliana]; contains Pfam
           profile PF00076: RNA recognition motif. (a.k.a. RRM,
           RBD, or RNP domain)
          Length = 262

 Score = 35.5 bits (78), Expect = 0.039
 Identities = 19/50 (38%), Positives = 26/50 (52%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           LR  F  FG +  + +  D  TG  RGFGF++F   DP D    +  HQ+
Sbjct: 53  LRRPFEQFGPVKDIYLPRDYYTGDPRGFGFIQF--MDPAD--AAEAKHQM 98


>At2g43370.1 68415.m05392 U1 small nuclear ribonucleoprotein 70 kDa,
           putative 
          Length = 333

 Score = 35.5 bits (78), Expect = 0.039
 Identities = 17/50 (34%), Positives = 27/50 (54%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           LRE  S +G I ++ +V    TG  RG+GFVE++    + R     +H +
Sbjct: 80  LREVMSKYGRIKNLRLVRHIVTGASRGYGFVEYETEKEMLRAYEDAHHSL 129



 Score = 28.3 bits (60), Expect = 5.9
 Identities = 14/54 (25%), Positives = 29/54 (53%), Gaps = 1/54 (1%)
 Frame = +3

Query: 234 IKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHK-IDGR 392
           ++ ++  +G I ++ +++   T  S+G+GF+ Y     +  A  +  H  IDGR
Sbjct: 80  LREVMSKYGRIKNLRLVRHIVTGASRGYGFVEYETEKEMLRAYEDAHHSLIDGR 133


>At2g16940.1 68415.m01952 RNA recognition motif (RRM)-containing
           protein
          Length = 561

 Score = 35.5 bits (78), Expect = 0.039
 Identities = 21/51 (41%), Positives = 30/51 (58%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQIK 658
           LR+ F +FG++  V V  D ETG  +GFGFV+F   +   R  L  N Q++
Sbjct: 301 LRKVFESFGSVELVQVPRD-ETGLCKGFGFVQFARLEDA-RNALNLNGQLE 349



 Score = 34.3 bits (75), Expect = 0.090
 Identities = 14/37 (37%), Positives = 23/37 (62%)
 Frame = +2

Query: 500 RRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDD 610
           R + E+FS  G +  V ++ D+ + + RG G+VEF D
Sbjct: 196 RDVYEFFSRAGKVRDVRIIMDRISRRSRGIGYVEFYD 232



 Score = 31.1 bits (67), Expect = 0.84
 Identities = 21/75 (28%), Positives = 39/75 (52%), Gaps = 1/75 (1%)
 Frame = +3

Query: 234 IKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQN-NRPHKIDGRIVEPKR 410
           ++++  ++G +  V V +D +T   KGFGF+ +++      A N N   +I GR ++   
Sbjct: 301 LRKVFESFGSVELVQVPRD-ETGLCKGFGFVQFARLEDARNALNLNGQLEIAGRAIKVSA 359

Query: 411 AVPREEIKRPEASAT 455
              + E+  PEA  T
Sbjct: 360 VTDQTEV--PEAGQT 372


>At1g73530.1 68414.m08511 RNA recognition motif (RRM)-containing
           protein low similarity to SP|Q03251 Glycine-rich
           RNA-binding protein 8 (CCR1 protein) {Arabidopsis
           thaliana}; contains InterPro entry IPR000504:
           RNA-binding region RNP-1 (RNA recognition motif) (RRM)
          Length = 181

 Score = 35.5 bits (78), Expect = 0.039
 Identities = 12/34 (35%), Positives = 23/34 (67%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFD 607
           LR+ F  FGN++ +++V DK   + +GF F+ ++
Sbjct: 93  LRDTFEQFGNLIHMNMVMDKVANRPKGFAFLRYE 126



 Score = 28.3 bits (60), Expect = 5.9
 Identities = 9/21 (42%), Positives = 17/21 (80%)
 Frame = +1

Query: 190 KLFIGGLDYRTTDSSLKEFYE 252
           KL++ GL +RTT+ +L++ +E
Sbjct: 78  KLYVSGLSFRTTEDTLRDTFE 98


>At1g71770.1 68414.m08295 polyadenylate-binding protein 5 (PABP5)
           identical to GB:Q05196 from [Arabidopsis thaliana]
          Length = 668

 Score = 35.5 bits (78), Expect = 0.039
 Identities = 16/36 (44%), Positives = 24/36 (66%)
 Frame = +2

Query: 500 RRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFD 607
           + L E FS+FG I+S  V  D   G+ +G+GFV+F+
Sbjct: 146 KALYETFSSFGTILSCKVAMDV-VGRSKGYGFVQFE 180



 Score = 28.7 bits (61), Expect = 4.5
 Identities = 23/94 (24%), Positives = 48/94 (51%), Gaps = 7/94 (7%)
 Frame = +3

Query: 252 AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRA-----V 416
           ++G I+   V  D    RSKG+GF+ + +    +E       K++G ++  K+      V
Sbjct: 154 SFGTILSCKVAMDV-VGRSKGYGFVQFEK----EETAQAAIDKLNGMLLNDKQVFVGHFV 208

Query: 417 PREEIKRPEASA--TVKKLFVAGLKQDIEEEDLE 512
            R++  R E+ A  +   ++V  L ++I +++L+
Sbjct: 209 RRQDRARSESGAVPSFTNVYVKNLPKEITDDELK 242


>At1g53720.1 68414.m06113 cyclophilin-RNA interacting protein,
           putative
          Length = 506

 Score = 35.5 bits (78), Expect = 0.039
 Identities = 14/50 (28%), Positives = 28/50 (56%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           L   FS FG +VS  V+ D +TG    + F+EF++ +  ++   + ++ +
Sbjct: 259 LHTIFSRFGTVVSADVIRDFKTGDSLCYAFIEFENKESCEQAYFKMDNAL 308


>At5g19030.2 68418.m02262 RNA recognition motif (RRM)-containing
           protein low similarity to Cold-inducible RNA-binding
           protein (Glycine-rich RNA-binding protein CIRP) from
           {Homo sapiens} SP|Q14011, {Rattus norvegicus}
           SP|Q61413,{Xenopus laevis} SP|O93235; contains InterPro
           entry IPR000504: RNA-binding region RNP-1 (RNA
           recognition motif) (RRM)
          Length = 126

 Score = 35.1 bits (77), Expect = 0.052
 Identities = 13/51 (25%), Positives = 28/51 (54%)
 Frame = +2

Query: 503 RLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           RL++ FS FG + +V ++ ++ T +  G+G+V F+  +         N ++
Sbjct: 73  RLKKVFSEFGQVTNVKIIANERTRQSLGYGYVWFNSKEDAQSAVEAMNGKV 123


>At5g06000.1 68418.m00665 eukaryotic translation initiation factor
           3G, putative / eIF3g, putative similar to eukaryotic
           translation initiation factor 3g [Arabidopsis thaliana]
           GI:12407751; contains InterPro entry IPR000504:
           RNA-binding region RNP-1 (RNA recognition motif) (RRM)
          Length = 276

 Score = 35.1 bits (77), Expect = 0.052
 Identities = 17/47 (36%), Positives = 22/47 (46%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQN 646
           L E F  FG +    V  D++T   RGFGFV F   +   R   + N
Sbjct: 190 LMELFRPFGAVTRCHVAIDQKTSMSRGFGFVSFVSREDAQRAINKLN 236



 Score = 27.9 bits (59), Expect = 7.8
 Identities = 15/60 (25%), Positives = 28/60 (46%), Gaps = 1/60 (1%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNN-RPHKIDGRIVEPKRAVPREEI 431
           +G +    V  D KT  S+GFGF+++        A N    +  D  I+  + + P+ ++
Sbjct: 197 FGAVTRCHVAIDQKTSMSRGFGFVSFVSREDAQRAINKLNGYGYDNLILRVEWSTPKTQL 256


>At4g03110.1 68417.m00420 RNA-binding protein, putative similar to
           Etr-1 [Danio rerio] GI:7670536, BRUNO-like 6 RNA-binding
           protein [Homo sapiens] GI:15341327, CUG-BP and ETR-3
           like factor 3 [Homo sapiens] GI:12746392; contains
           InterPro entry IPR000504: RNA-binding region RNP-1 (RNA
           recognition motif) (RRM)
          Length = 441

 Score = 35.1 bits (77), Expect = 0.052
 Identities = 15/36 (41%), Positives = 21/36 (58%)
 Frame = +2

Query: 500 RRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFD 607
           + L   F +FG ++S  V  DK TG  + FGFV +D
Sbjct: 363 QELAAAFQSFGIVLSAKVFVDKATGVSKCFGFVSYD 398


>At2g44710.1 68415.m05564 RNA recognition motif (RRM)-containing
           protein 
          Length = 809

 Score = 35.1 bits (77), Expect = 0.052
 Identities = 13/42 (30%), Positives = 26/42 (61%)
 Frame = +3

Query: 234 IKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEA 359
           +K++    GE+ +V ++K+P+TK+SKG  F+ ++       A
Sbjct: 230 LKKVFGHVGEVTEVRILKNPQTKKSKGSAFLRFATVEQAKRA 271


>At1g54080.1 68414.m06162 oligouridylate-binding protein, putative
           similar to oligouridylate binding protein GI:6996560
           from [Nicotiana plumbaginifolia]
          Length = 426

 Score = 35.1 bits (77), Expect = 0.052
 Identities = 15/33 (45%), Positives = 21/33 (63%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEF 604
           L + FS F +     V+ D++TG+ RGFGFV F
Sbjct: 164 LFDSFSAFNSCSDARVMWDQKTGRSRGFGFVSF 196



 Score = 31.1 bits (67), Expect = 0.84
 Identities = 15/38 (39%), Positives = 20/38 (52%)
 Frame = +3

Query: 252 AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQN 365
           A+    D  VM D KT RS+GFGF+++        A N
Sbjct: 170 AFNSCSDARVMWDQKTGRSRGFGFVSFRNQQDAQTAIN 207


>At1g16610.2 68414.m01990 arginine/serine-rich protein, putative
           (SR45) similar to arginine/serine-rich protein
           GI:6601502 from [Arabidopsis thaliana]
          Length = 407

 Score = 35.1 bits (77), Expect = 0.052
 Identities = 13/33 (39%), Positives = 19/33 (57%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEF 604
           L+E F  FG ++ V +  D+     RG G+VEF
Sbjct: 114 LKEIFGNFGEVIHVEIAMDRAVNLPRGHGYVEF 146



 Score = 31.1 bits (67), Expect = 0.84
 Identities = 17/71 (23%), Positives = 36/71 (50%), Gaps = 2/71 (2%)
 Frame = +3

Query: 234 IKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRP-HKIDGRIVEPKR 410
           +K I   +GE++ V +  D      +G G++ +      ++AQ      +IDG++V+   
Sbjct: 114 LKEIFGNFGEVIHVEIAMDRAVNLPRGHGYVEFKARADAEKAQLYMDGAQIDGKVVKATF 173

Query: 411 AV-PREEIKRP 440
            + PR+++  P
Sbjct: 174 TLPPRQKVSSP 184


>At1g16610.1 68414.m01989 arginine/serine-rich protein, putative
           (SR45) similar to arginine/serine-rich protein
           GI:6601502 from [Arabidopsis thaliana]
          Length = 414

 Score = 35.1 bits (77), Expect = 0.052
 Identities = 13/33 (39%), Positives = 19/33 (57%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEF 604
           L+E F  FG ++ V +  D+     RG G+VEF
Sbjct: 114 LKEIFGNFGEVIHVEIAMDRAVNLPRGHGYVEF 146



 Score = 31.1 bits (67), Expect = 0.84
 Identities = 17/71 (23%), Positives = 36/71 (50%), Gaps = 2/71 (2%)
 Frame = +3

Query: 234 IKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRP-HKIDGRIVEPKR 410
           +K I   +GE++ V +  D      +G G++ +      ++AQ      +IDG++V+   
Sbjct: 114 LKEIFGNFGEVIHVEIAMDRAVNLPRGHGYVEFKARADAEKAQLYMDGAQIDGKVVKATF 173

Query: 411 AV-PREEIKRP 440
            + PR+++  P
Sbjct: 174 TLPPRQKVSSP 184


>At5g19030.1 68418.m02261 RNA recognition motif (RRM)-containing
           protein low similarity to Cold-inducible RNA-binding
           protein (Glycine-rich RNA-binding protein CIRP) from
           {Homo sapiens} SP|Q14011, {Rattus norvegicus}
           SP|Q61413,{Xenopus laevis} SP|O93235; contains InterPro
           entry IPR000504: RNA-binding region RNP-1 (RNA
           recognition motif) (RRM)
          Length = 172

 Score = 34.7 bits (76), Expect = 0.068
 Identities = 12/35 (34%), Positives = 24/35 (68%)
 Frame = +2

Query: 503 RLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFD 607
           RL++ FS FG + +V ++ ++ T +  G+G+V F+
Sbjct: 92  RLKKVFSEFGQVTNVKIIANERTRQSLGYGYVWFN 126


>At5g18810.1 68418.m02235 SC35-like splicing factor, 28 kD (SCL28)
           nearly identical to SC35-like splicing factor SCL28, 28
           kD [Arabidopsis thaliana] GI:9843655; contains Pfam
           profile PF00076: RNA recognition motif. (a.k.a. RRM,
           RBD, or RNP domain)
          Length = 236

 Score = 34.7 bits (76), Expect = 0.068
 Identities = 15/50 (30%), Positives = 27/50 (54%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           LR+ F  FG +  + +  +  TG+ RGFGFV++   +       + NH++
Sbjct: 63  LRDSFERFGPLKDIYLPRNYYTGEPRGFGFVKYRYAEDAAEAMKRMNHKV 112



 Score = 32.3 bits (70), Expect = 0.36
 Identities = 14/45 (31%), Positives = 23/45 (51%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDG 389
           +G + D+ + ++  T   +GFGF+ Y  A    EA     HK+ G
Sbjct: 70  FGPLKDIYLPRNYYTGEPRGFGFVKYRYAEDAAEAMKRMNHKVIG 114


>At5g03580.1 68418.m00316 polyadenylate-binding protein, putative /
           PABP, putative similar to poly(A)-binding protein
           [Triticum aestivum] GI:1737492; contains InterPro entry
           IPR000504: RNA-binding region RNP-1 (RNA recognition
           motif) (RRM)
          Length = 101

 Score = 34.7 bits (76), Expect = 0.068
 Identities = 16/46 (34%), Positives = 25/46 (54%)
 Frame = +2

Query: 518 FSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           FS FG ++  SV+     G+ RGF F+EF+  D   R  L  + ++
Sbjct: 37  FSDFGKVIR-SVLAKDFRGESRGFAFIEFESADSAGRAMLHMDGRL 81


>At1g49600.1 68414.m05561 RNA-binding protein 47 (RBP47), putative
           similar to DNA binding protein ACBF GB:U90212 GI:1899187
           from [Nicotiana tabacum]
          Length = 445

 Score = 34.7 bits (76), Expect = 0.068
 Identities = 14/47 (29%), Positives = 23/47 (48%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQN 646
           L  +   + ++    VV D  TG+ +G+GFV F D +   R   + N
Sbjct: 230 LETFAGRYPSVKGAKVVIDSNTGRSKGYGFVRFGDENERSRAMTEMN 276



 Score = 31.9 bits (69), Expect = 0.48
 Identities = 14/33 (42%), Positives = 20/33 (60%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEF 604
           L   FS    + SV V+ +K+T +  G+GFVEF
Sbjct: 135 LHTCFSHTNEVSSVKVIRNKQTCQSEGYGFVEF 167


>At1g07350.2 68414.m00784 transformer serine/arginine-rich
           ribonucleoprotein, putative similar to GB:Y09506 from
           [Nicotiana tabacum] (Plant Mol. Biol. 35 (3), 261-269
           (1997))
          Length = 129

 Score = 34.7 bits (76), Expect = 0.068
 Identities = 15/52 (28%), Positives = 25/52 (48%)
 Frame = +2

Query: 500 RRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           R L ++F+  G +  V +V D  T + RGFGF+        +R     +H +
Sbjct: 59  RDLEDHFAKEGKVTDVHLVLDPWTRESRGFGFISMKSVGDANRCIRSLDHSV 110



 Score = 34.7 bits (76), Expect = 0.068
 Identities = 15/48 (31%), Positives = 27/48 (56%), Gaps = 1/48 (2%)
 Frame = +3

Query: 258 GEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKI-DGRIV 398
           G++ DV ++ DP T+ S+GFGFI+       +    +  H +  GR++
Sbjct: 69  GKVTDVHLVLDPWTRESRGFGFISMKSVGDANRCIRSLDHSVLQGRVI 116


>At1g03457.2 68414.m00327 RNA-binding protein, putative similar to
           Etr-1 [Danio rerio] GI:7670536, BRUNO-like 6 RNA-binding
           protein [Homo sapiens] GI:15341327; contains InterPro
           entry IPR000504: RNA-binding region RNP-1 (RNA
           recognition motif) (RRM)
          Length = 438

 Score = 34.7 bits (76), Expect = 0.068
 Identities = 14/36 (38%), Positives = 20/36 (55%)
 Frame = +2

Query: 500 RRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFD 607
           + L   F  FG ++S  V  DK TG  + FGF+ +D
Sbjct: 353 QELAATFQPFGKVLSAKVFVDKATGISKCFGFISYD 388


>At1g03457.1 68414.m00326 RNA-binding protein, putative similar to
           Etr-1 [Danio rerio] GI:7670536, BRUNO-like 6 RNA-binding
           protein [Homo sapiens] GI:15341327; contains InterPro
           entry IPR000504: RNA-binding region RNP-1 (RNA
           recognition motif) (RRM)
          Length = 429

 Score = 34.7 bits (76), Expect = 0.068
 Identities = 14/36 (38%), Positives = 20/36 (55%)
 Frame = +2

Query: 500 RRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFD 607
           + L   F  FG ++S  V  DK TG  + FGF+ +D
Sbjct: 344 QELAATFQPFGKVLSAKVFVDKATGISKCFGFISYD 379


>At5g65260.1 68418.m08209 polyadenylate-binding protein family
           protein / PABP family protein low similarity to
           poly(A)-binding protein II [Drosophila melanogaster]
           GI:6007612; contains InterPro entry IPR000504:
           RNA-binding region RNP-1 (RNA recognition motif) (RRM)
           domain
          Length = 220

 Score = 34.3 bits (75), Expect = 0.090
 Identities = 17/47 (36%), Positives = 30/47 (63%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQN 646
           ++++F T G +  V+++TDK  G+ +GF +VEF + + V    LQ N
Sbjct: 108 VQQHFQTCGTVHRVTILTDK-FGQPKGFAYVEFVEVEAVQE-ALQLN 152


>At5g59860.1 68418.m07506 RNA recognition motif (RRM)-containing
           protein similar to SP|Q14011 Cold-inducible RNA-binding
           protein (Glycine-rich RNA-binding protein CIRP) {Homo
           sapiens}; contains InterPro entry IPR000504: RNA-binding
           region RNP-1 (RNA recognition motif) (RRM)
          Length = 157

 Score = 33.9 bits (74), Expect = 0.12
 Identities = 24/62 (38%), Positives = 34/62 (54%)
 Frame = +3

Query: 279 VMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEIKRPEASATV 458
           ++KD +T+R KGFGFIT+      D+AQ      ++G+IV   R +  E  K  EA  T 
Sbjct: 97  LIKDQQTQRPKGFGFITFESE---DDAQ-KALKALNGKIVN-GRLIFVETAKEVEAPTTS 151

Query: 459 KK 464
            K
Sbjct: 152 LK 153



 Score = 30.3 bits (65), Expect = 1.5
 Identities = 14/50 (28%), Positives = 26/50 (52%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           LR+ F+ F  ++      D++T + +GFGF+ F+  D   +     N +I
Sbjct: 87  LRQLFAPFARLIK-----DQQTQRPKGFGFITFESEDDAQKALKALNGKI 131


>At5g41690.1 68418.m05067 polyadenylate-binding protein, putative /
           PABP, putative similar to poly(A)-binding protein
           GI:7673355 from [Nicotiana tabacum]; contains InterPro
           entry IPR000504: RNA-binding region RNP-1 (RNA
           recognition motif) (RRM)
          Length = 620

 Score = 33.5 bits (73), Expect = 0.16
 Identities = 15/45 (33%), Positives = 26/45 (57%)
 Frame = +2

Query: 512 EYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQN 646
           ++F+  G +VS+ ++ + E GK  G+GFVEF   D   +    +N
Sbjct: 262 DFFNCVGEVVSIRLMVNHE-GKHVGYGFVEFASADETKKALENKN 305


>At5g19960.1 68418.m02376 RNA recognition motif (RRM)-containing
           protein low similarity to glycine-rich RNA-binding
           protein [Euphorbia esula] GI:2645699; contains
           INTERPRO:IPR000504 RNA-binding region RNP-1 (RNA
           recognition motif) (RRM) domain
          Length = 337

 Score = 33.5 bits (73), Expect = 0.16
 Identities = 17/56 (30%), Positives = 32/56 (57%), Gaps = 1/56 (1%)
 Frame = +3

Query: 234 IKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHK-IDGRIV 398
           ++R+   +G ++ V ++ D ++ R K +GF+T+S     D+A  +   K I GR V
Sbjct: 23  VRRVFSIYGSVLTVKIVND-RSVRGKCYGFVTFSNRRSADDAIEDMDGKSIGGRAV 77


>At3g52150.1 68416.m05724 RNA recognition motif (RRM)-containing
           protein similar to chloroplast RNA-binding protein cp33
           [Arabidopsis thaliana] GI:681912; contains InterPro
           entry IPR000504: RNA-binding region RNP-1 (RNA
           recognition motif) (RRM) domain
          Length = 253

 Score = 33.5 bits (73), Expect = 0.16
 Identities = 14/34 (41%), Positives = 21/34 (61%)
 Frame = +3

Query: 258 GEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEA 359
           G++V   V + P T +S GFGF+T+S    V+ A
Sbjct: 201 GKVVSAKVSRVPGTSKSTGFGFVTFSSEEDVEAA 234


>At3g50670.1 68416.m05542 U1 small nuclear ribonucleoprotein 70
           (U1-70k)
          Length = 427

 Score = 33.5 bits (73), Expect = 0.16
 Identities = 12/34 (35%), Positives = 23/34 (67%)
 Frame = +2

Query: 503 RLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEF 604
           +++  F ++G I  V +VTD+ T K +G+ F+E+
Sbjct: 153 KIKREFESYGPIKRVHLVTDQLTNKPKGYAFIEY 186



 Score = 31.9 bits (69), Expect = 0.48
 Identities = 25/73 (34%), Positives = 33/73 (45%), Gaps = 5/73 (6%)
 Frame = +3

Query: 234 IKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRP-HKIDGR----IV 398
           IKR   ++G I  V ++ D  T + KG+ FI Y     +  A       KIDGR     V
Sbjct: 154 IKREFESYGPIKRVHLVTDQLTNKPKGYAFIEYMHTRDMKAAYKQADGQKIDGRRVLVDV 213

Query: 399 EPKRAVPREEIKR 437
           E  R VP    +R
Sbjct: 214 ERGRTVPNWRPRR 226


>At3g04500.1 68416.m00477 RNA recognition motif (RRM)-containing
           protein similar to ssRNA-binding protein [Dictyostelium
           discoideum] GI:1546894; contains InterPro entry
           IPR000504: RNA-binding region RNP-1 (RNA recognition
           motif) (RRM)
          Length = 245

 Score = 33.5 bits (73), Expect = 0.16
 Identities = 14/33 (42%), Positives = 19/33 (57%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEF 604
           L + F+ F       V+ DK TGK +G+GFV F
Sbjct: 153 LSKAFARFPTFNMAKVIRDKRTGKTKGYGFVSF 185


>At3g12640.1 68416.m01573 RNA recognition motif (RRM)-containing
           protein contains InterPro entry IPR000504: RNA-binding
           region RNP-1 (RNA recognition motif) (RRM)
          Length = 674

 Score = 33.1 bits (72), Expect = 0.21
 Identities = 12/33 (36%), Positives = 20/33 (60%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEF 604
           L  +F+ FG ++   +VTD  TG+  G  ++EF
Sbjct: 532 LSRHFNKFGEVLKAFIVTDPATGQPSGSAYIEF 564


>At1g60000.1 68414.m06759 29 kDa ribonucleoprotein, chloroplast,
           putative / RNA-binding protein cp29, putative similar to
           29 kDa ribonucleoprotein chloroplast precursor
           {Nicotiana sylvestris} SP|Q08935, SP|Q08937; contains
           InterPro entry IPR000504: RNA-binding region RNP-1 (RNA
           recognition motif) (RRM) contains an AG-donor site at
           intron.
          Length = 258

 Score = 32.7 bits (71), Expect = 0.28
 Identities = 16/48 (33%), Positives = 29/48 (60%), Gaps = 1/48 (2%)
 Frame = +3

Query: 258 GEIVDVVVMKDPKTKRSKGFGFITY-SQAHMVDEAQNNRPHKIDGRIV 398
           G++V   V+ D  T RS+G+GF+ Y S+A M    ++    +++GR +
Sbjct: 201 GDVVGARVVFDGDTGRSRGYGFVCYSSKAEMETALESLDGFELEGRAI 248



 Score = 32.3 bits (70), Expect = 0.36
 Identities = 13/27 (48%), Positives = 18/27 (66%)
 Frame = +2

Query: 518 FSTFGNIVSVSVVTDKETGKKRGFGFV 598
           F   G++V   VV D +TG+ RG+GFV
Sbjct: 197 FRECGDVVGARVVFDGDTGRSRGYGFV 223



 Score = 30.7 bits (66), Expect = 1.1
 Identities = 25/84 (29%), Positives = 39/84 (46%), Gaps = 1/84 (1%)
 Frame = +3

Query: 261 EIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRP-HKIDGRIVEPKRAVPREEIKR 437
           E+V+V+  +D  T +S+GF F+T S     +   +N    +  GR ++   A   +  K 
Sbjct: 112 ELVEVLYNRD--TGQSRGFAFVTMSNVEDCNIIIDNLDGTEYLGRALKVNFADKPKPNKE 169

Query: 438 PEASATVKKLFVAGLKQDIEEEDL 509
           P    T  KLFV  L   +  E L
Sbjct: 170 PLYPETEHKLFVGNLSWTVTSESL 193



 Score = 28.3 bits (60), Expect = 5.9
 Identities = 12/37 (32%), Positives = 20/37 (54%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYD 616
           L +    F N   V V+ +++TG+ RGF FV   + +
Sbjct: 101 LAQIIQDFANPELVEVLYNRDTGQSRGFAFVTMSNVE 137


>At3g10400.1 68416.m01246 RNA recognition motif (RRM)-containing
           protein low similarity to splicing factor SC35
           [Arabidopsis thaliana] GI:9843653; contains InterPro
           entry IPR000504: RNA-binding region RNP-1 (RNA
           recognition motif) (RRM)
          Length = 261

 Score = 32.3 bits (70), Expect = 0.36
 Identities = 13/27 (48%), Positives = 18/27 (66%)
 Frame = +2

Query: 518 FSTFGNIVSVSVVTDKETGKKRGFGFV 598
           FSTFG +  V+V+ D+ T + RG  FV
Sbjct: 77  FSTFGKVARVTVLKDRHTRQSRGVAFV 103



 Score = 30.3 bits (65), Expect = 1.5
 Identities = 19/70 (27%), Positives = 34/70 (48%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEIK 434
           +G++  V V+KD  T++S+G  F+ Y      D A+  R   +D +I+  ++        
Sbjct: 80  FGKVARVTVLKDRHTRQSRGVAFVLYVSRE--DAAKAAR--SMDAKILNGRKLTVSIAAD 135

Query: 435 RPEASATVKK 464
              AS  +KK
Sbjct: 136 NGRASEFIKK 145


>At1g17370.1 68414.m02118 oligouridylate-binding protein, putative
           similar to oligouridylate binding protein [Nicotiana
           plumbaginifolia] GI:6996560; contains InterPro entry
           IPR000504: RNA-binding region RNP-1 (RNA recognition
           motif) (RRM)
          Length = 419

 Score = 32.3 bits (70), Expect = 0.36
 Identities = 13/29 (44%), Positives = 18/29 (62%)
 Frame = +2

Query: 518 FSTFGNIVSVSVVTDKETGKKRGFGFVEF 604
           FS +       V+ D++TG+ RGFGFV F
Sbjct: 159 FSVYPTCSDARVMWDQKTGRSRGFGFVSF 187



 Score = 29.9 bits (64), Expect = 1.9
 Identities = 12/21 (57%), Positives = 16/21 (76%)
 Frame = +3

Query: 270 DVVVMKDPKTKRSKGFGFITY 332
           D  VM D KT RS+GFGF+++
Sbjct: 167 DARVMWDQKTGRSRGFGFVSF 187


>At1g13690.1 68414.m01609 RNA recognition motif (RRM)-containing
           protein contains Pfam profile: PF00076 RNA recognition
           motif
          Length = 177

 Score = 32.3 bits (70), Expect = 0.36
 Identities = 19/64 (29%), Positives = 34/64 (53%), Gaps = 1/64 (1%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRP-HKIDGRIVEPKRAVPREEI 431
           +G+I DV    D   ++ + FGF+T+ +      A +N    ++ GR++    A+P E+I
Sbjct: 36  FGDIKDVKTPLDQANQKHRSFGFVTFLEREDASAAMDNMDGAELYGRVLTVNYALP-EKI 94

Query: 432 KRPE 443
           K  E
Sbjct: 95  KGGE 98



 Score = 28.3 bits (60), Expect = 5.9
 Identities = 14/33 (42%), Positives = 16/33 (48%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEF 604
           L   F  FG+I  V    D+   K R FGFV F
Sbjct: 29  LHAAFIPFGDIKDVKTPLDQANQKHRSFGFVTF 61


>At5g51120.1 68418.m06339 polyadenylate-binding protein, putative /
           PABP, putative contains similarity to poly(A)-binding
           protein II [Mus musculus] GI:2351846; contains InterPro
           entry IPR000504: RNA-binding region RNP-1 (RNA
           recognition motif) (RRM)
          Length = 227

 Score = 31.9 bits (69), Expect = 0.48
 Identities = 13/39 (33%), Positives = 27/39 (69%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPV 622
           ++++F + G +  V+++TDK  G+ +GF +VEF + + V
Sbjct: 119 VQQHFQSCGTVNRVTILTDK-FGQPKGFAYVEFVEVEAV 156


>At1g45100.1 68414.m05170 polyadenylate-binding protein, putative /
           PABP, putative similar to polyadenylate-binding protein
           (poly(A)-binding protein) from {Arabidopsis thaliana}
           SP|P42731, [Nicotiana tabacum] GI:7673355, [Cucumis
           sativus] GI:7528270; contains InterPro entry IPR000504:
           RNA-binding region RNP-1 (RNA recognition motif) (RRM)
          Length = 497

 Score = 31.9 bits (69), Expect = 0.48
 Identities = 13/52 (25%), Positives = 27/52 (51%)
 Frame = +2

Query: 515 YFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQIKRFNI 670
           +F   G +V V ++ + + GK  G+GFVEF   +  ++  ++    +  + I
Sbjct: 266 FFKDVGEVVHVRLIVNSQ-GKHAGWGFVEFASANEAEKALVKNGEYLHNYKI 316



 Score = 30.3 bits (65), Expect = 1.5
 Identities = 14/33 (42%), Positives = 22/33 (66%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEF 604
           ++ +F+    +VSV +V + E GK  G+GFVEF
Sbjct: 174 IKGFFNGVAQVVSVRLVVNHE-GKHVGYGFVEF 205


>At4g10110.1 68417.m01654 RNA recognition motif (RRM)-containing
           protein contains INTERPRO:IPR000504 RNA-binding region
           RNP-1 (RNA recognition motif) domain
          Length = 173

 Score = 31.5 bits (68), Expect = 0.64
 Identities = 11/32 (34%), Positives = 19/32 (59%)
 Frame = +2

Query: 530 GNIVSVSVVTDKETGKKRGFGFVEFDDYDPVD 625
           G ++ + +  DKET K +GF F E++  +  D
Sbjct: 31  GRVIDLHIPRDKETDKPKGFAFAEYETEEIAD 62



 Score = 30.3 bits (65), Expect = 1.5
 Identities = 11/34 (32%), Positives = 19/34 (55%)
 Frame = +3

Query: 258 GEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEA 359
           G ++D+ + +D +T + KGF F  Y    + D A
Sbjct: 31  GRVIDLHIPRDKETDKPKGFAFAEYETEEIADYA 64


>At4g03110.2 68417.m00421 RNA-binding protein, putative similar to
           Etr-1 [Danio rerio] GI:7670536, BRUNO-like 6 RNA-binding
           protein [Homo sapiens] GI:15341327, CUG-BP and ETR-3
           like factor 3 [Homo sapiens] GI:12746392; contains
           InterPro entry IPR000504: RNA-binding region RNP-1 (RNA
           recognition motif) (RRM)
          Length = 439

 Score = 31.5 bits (68), Expect = 0.64
 Identities = 14/36 (38%), Positives = 20/36 (55%)
 Frame = +2

Query: 500 RRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFD 607
           + L   F +FG ++S  V  DK TG  + FG + FD
Sbjct: 362 QELAAAFQSFGIVLSAKVFVDKATGVSKCFGKLSFD 397


>At2g41060.1 68415.m05070 RNA recognition motif (RRM)-containing
           protein similar to UBP1 interacting protein 1a
           [Arabidopsis thaliana] GI:19574236; contains InterPro
           entry IPR000504: RNA-binding region RNP-1 (RNA
           recognition motif) (RRM)
          Length = 451

 Score = 31.5 bits (68), Expect = 0.64
 Identities = 15/51 (29%), Positives = 27/51 (52%)
 Frame = +2

Query: 500 RRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQ 652
           ++L E+FS FG I    +  DK TG+ +GF    +   +   +  L++ H+
Sbjct: 241 QKLLEFFSRFGEIEEGPLGLDKATGRPKGFALFVYRSLESAKK-ALEEPHK 290


>At3g56860.3 68416.m06325 UBP1 interacting protein 2a (UBA2a)
           identical to UBP1 interacting protein 2a [Arabidopsis
           thaliana] GI:19682816; contains InterPro entry
           IPR000504: RNA-binding region RNP-1 (RNA recognition
           motif) (RRM)
          Length = 478

 Score = 31.1 bits (67), Expect = 0.84
 Identities = 13/31 (41%), Positives = 18/31 (58%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFV 598
           L E F  +G I     V DK +GK +G+GF+
Sbjct: 156 LIEAFKQYGEIEDCKAVFDKISGKSKGYGFI 186



 Score = 29.9 bits (64), Expect = 1.9
 Identities = 16/47 (34%), Positives = 22/47 (46%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRI 395
           +GEI D   + D  + +SKG+GFI Y        A      KI  R+
Sbjct: 163 YGEIEDCKAVFDKISGKSKGYGFILYKSRSGARNALKQPQKKIGSRM 209



 Score = 28.3 bits (60), Expect = 5.9
 Identities = 15/51 (29%), Positives = 26/51 (50%)
 Frame = +2

Query: 500 RRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQ 652
           ++L  +FS FG I    +  DK TG+ +GF    +   +   R  L++ H+
Sbjct: 259 QKLLMFFSKFGEIEEGPLGLDKYTGRPKGFCLFVYKSSESAKR-ALEEPHK 308


>At3g56860.2 68416.m06324 UBP1 interacting protein 2a (UBA2a)
           identical to UBP1 interacting protein 2a [Arabidopsis
           thaliana] GI:19682816; contains InterPro entry
           IPR000504: RNA-binding region RNP-1 (RNA recognition
           motif) (RRM)
          Length = 478

 Score = 31.1 bits (67), Expect = 0.84
 Identities = 13/31 (41%), Positives = 18/31 (58%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFV 598
           L E F  +G I     V DK +GK +G+GF+
Sbjct: 156 LIEAFKQYGEIEDCKAVFDKISGKSKGYGFI 186



 Score = 29.9 bits (64), Expect = 1.9
 Identities = 16/47 (34%), Positives = 22/47 (46%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRI 395
           +GEI D   + D  + +SKG+GFI Y        A      KI  R+
Sbjct: 163 YGEIEDCKAVFDKISGKSKGYGFILYKSRSGARNALKQPQKKIGSRM 209



 Score = 28.3 bits (60), Expect = 5.9
 Identities = 15/51 (29%), Positives = 26/51 (50%)
 Frame = +2

Query: 500 RRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQ 652
           ++L  +FS FG I    +  DK TG+ +GF    +   +   R  L++ H+
Sbjct: 259 QKLLMFFSKFGEIEEGPLGLDKYTGRPKGFCLFVYKSSESAKR-ALEEPHK 308


>At3g56860.1 68416.m06323 UBP1 interacting protein 2a (UBA2a)
           identical to UBP1 interacting protein 2a [Arabidopsis
           thaliana] GI:19682816; contains InterPro entry
           IPR000504: RNA-binding region RNP-1 (RNA recognition
           motif) (RRM)
          Length = 478

 Score = 31.1 bits (67), Expect = 0.84
 Identities = 13/31 (41%), Positives = 18/31 (58%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFV 598
           L E F  +G I     V DK +GK +G+GF+
Sbjct: 156 LIEAFKQYGEIEDCKAVFDKISGKSKGYGFI 186



 Score = 29.9 bits (64), Expect = 1.9
 Identities = 16/47 (34%), Positives = 22/47 (46%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRI 395
           +GEI D   + D  + +SKG+GFI Y        A      KI  R+
Sbjct: 163 YGEIEDCKAVFDKISGKSKGYGFILYKSRSGARNALKQPQKKIGSRM 209



 Score = 28.3 bits (60), Expect = 5.9
 Identities = 15/51 (29%), Positives = 26/51 (50%)
 Frame = +2

Query: 500 RRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQ 652
           ++L  +FS FG I    +  DK TG+ +GF    +   +   R  L++ H+
Sbjct: 259 QKLLMFFSKFGEIEEGPLGLDKYTGRPKGFCLFVYKSSESAKR-ALEEPHK 308


>At2g39090.1 68415.m04803 tetratricopeptide repeat (TPR)-containing
           protein low similarity to prediabetic NOD sera-reactive
           autoantigen [Mus musculus] GI:6670773,
           anaphase-promoting complex subunit 7 [Homo sapiens]
           GI:6180015; contains Pfam profile PF00515: TPR Domain
          Length = 558

 Score = 31.1 bits (67), Expect = 0.84
 Identities = 13/38 (34%), Positives = 21/38 (55%)
 Frame = -1

Query: 253 AHRILLMKNLWFYSRVHR*KVYVCVQVLHSHRRFPKAS 140
           A  ++L+ +  F+ R HR  ++   Q LH + R PK S
Sbjct: 43  AENLILLGDALFHQREHRRAIHTYKQALHHYTRIPKQS 80


>At2g27330.1 68415.m03286 RNA recognition motif (RRM)-containing
           protein
          Length = 116

 Score = 31.1 bits (67), Expect = 0.84
 Identities = 15/49 (30%), Positives = 27/49 (55%), Gaps = 1/49 (2%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEA-QNNRPHKIDGRIV 398
           +G+++ V V+ D    R KGF ++T+S     ++A        +DGR+V
Sbjct: 44  YGQVLKVDVIMDKIRCRPKGFAYVTFSSKEEAEKALLELNAQLVDGRVV 92


>At2g24350.1 68415.m02910 RNA recognition motif (RRM)-containing
           protein low similarity to poly(A) binding protein II
           from [Xenopus laevis] GI:11527140, [Mus musculus]
           GI:2351846, [Bos taurus] GI:1051125; contains
           INTERPRO:IPR000504 RNA-binding region RNP-1 (RNA
           recognition motif) domain
          Length = 537

 Score = 31.1 bits (67), Expect = 0.84
 Identities = 12/34 (35%), Positives = 21/34 (61%)
 Frame = +3

Query: 258 GEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEA 359
           G + +V+V+ DP T+  KG  F+T++    V +A
Sbjct: 469 GAVQNVIVVTDPVTRHPKGTAFVTFATKESVGKA 502


>At4g09040.1 68417.m01491 RNA recognition motif (RRM)-containing
           protein low similarity to enhancer binding protein-1;
           EBP1 [Entamoeba histolytica] GI:8163877, SP|P19682 28
           kDa ribonucleoprotein, chloroplast precursor (28RNP)
           {Nicotiana sylvestris}; contains InterPro entry
           IPR000504: RNA-binding region RNP-1 (RNA recognition
           motif) (RRM)
          Length = 304

 Score = 30.7 bits (66), Expect = 1.1
 Identities = 13/36 (36%), Positives = 21/36 (58%), Gaps = 1/36 (2%)
 Frame = +2

Query: 500 RRLREYFST-FGNIVSVSVVTDKETGKKRGFGFVEF 604
           + L+E+F    GN+VS  V+  +   +  G+GFV F
Sbjct: 203 KHLKEFFDADTGNVVSTEVIFHENPRRSSGYGFVSF 238


>At1g60200.1 68414.m06781 splicing factor PWI domain-containing
           protein / RNA recognition motif (RRM)-containing protein
           contains Pfam profiles PF01480: PWI domain, PF00076: RNA
           recognition motif. (a.k.a. RRM, RBD, or RNP domain)
          Length = 899

 Score = 30.7 bits (66), Expect = 1.1
 Identities = 14/37 (37%), Positives = 20/37 (54%)
 Frame = +3

Query: 231 FIKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQA 341
           F+  IL   G +   +  +DP TK+ KGFGF  +  A
Sbjct: 218 FMMSILEFCGHVKSCLRAEDPTTKKPKGFGFYEFESA 254


>At5g10350.2 68418.m01201 polyadenylate-binding protein family
           protein / PABP family protein contains weak similarity
           to poly(A) binding protein II from [Mus musculus]
           GI:2351846, [Xenopus laevis] GI:11527140; contains
           InterPro entry IPR000504: RNA-binding region RNP-1 (RNA
           recognition motif) (RRM)
          Length = 202

 Score = 30.3 bits (65), Expect = 1.5
 Identities = 16/44 (36%), Positives = 26/44 (59%)
 Frame = +2

Query: 515 YFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQN 646
           +F T G +  V+++ DK  G+ +GF +VEF + + V    LQ N
Sbjct: 108 HFQTCGTVNRVTILMDK-FGQPKGFAYVEFVEVEAVQE-ALQLN 149


>At5g10350.1 68418.m01200 polyadenylate-binding protein family
           protein / PABP family protein contains weak similarity
           to poly(A) binding protein II from [Mus musculus]
           GI:2351846, [Xenopus laevis] GI:11527140; contains
           InterPro entry IPR000504: RNA-binding region RNP-1 (RNA
           recognition motif) (RRM)
          Length = 217

 Score = 30.3 bits (65), Expect = 1.5
 Identities = 16/44 (36%), Positives = 26/44 (59%)
 Frame = +2

Query: 515 YFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQN 646
           +F T G +  V+++ DK  G+ +GF +VEF + + V    LQ N
Sbjct: 108 HFQTCGTVNRVTILMDK-FGQPKGFAYVEFVEVEAVQE-ALQLN 149


>At5g09830.1 68418.m01137 BolA-like family protein contains Pfam
           profile: PF01722 BolA-like protein
          Length = 93

 Score = 30.3 bits (65), Expect = 1.5
 Identities = 17/47 (36%), Positives = 27/47 (57%)
 Frame = +1

Query: 301 RDQKDLDLLHILKPIWLMKLKIIGLTKLTEELSSQNEQFQGKRLKDQ 441
           ++Q +  L   LKPI L  + I G    + E+   +EQF+GKRL ++
Sbjct: 4   KEQVEASLTSKLKPIHLEVIDISGGCGSSFEVEVVSEQFEGKRLLER 50


>At2g47310.1 68415.m05906 flowering time control protein-related /
           FCA gamma-related 
          Length = 512

 Score = 30.3 bits (65), Expect = 1.5
 Identities = 9/33 (27%), Positives = 21/33 (63%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEF 604
           +R+ F  +GN+  + +  DK TG++  + F+++
Sbjct: 126 IRQVFEKYGNVTEIILPKDKMTGERAAYCFIKY 158


>At1g54080.2 68414.m06163 oligouridylate-binding protein, putative
           similar to oligouridylate binding protein GI:6996560
           from [Nicotiana plumbaginifolia]
          Length = 430

 Score = 30.3 bits (65), Expect = 1.5
 Identities = 14/32 (43%), Positives = 18/32 (56%)
 Frame = +3

Query: 270 DVVVMKDPKTKRSKGFGFITYSQAHMVDEAQN 365
           D  VM D KT RS+GFGF+++        A N
Sbjct: 180 DARVMWDQKTGRSRGFGFVSFRNQQDAQTAIN 211



 Score = 29.9 bits (64), Expect = 1.9
 Identities = 16/37 (43%), Positives = 22/37 (59%), Gaps = 4/37 (10%)
 Frame = +2

Query: 506 LREYFSTFGNIVS----VSVVTDKETGKKRGFGFVEF 604
           L + FS F +  S      V+ D++TG+ RGFGFV F
Sbjct: 164 LFDSFSAFNSCSSYYRDARVMWDQKTGRSRGFGFVSF 200


>At5g13010.1 68418.m01491 RNA helicase, putative similar to DEAH-box
           RNA helicase [Chlamydomonas reinhardtii] GI:12044832;
           contains Pfam profiles PF04408: Helicase associated
           domain (HA2), PF00271: Helicase conserved C-terminal
           domain
          Length = 1226

 Score = 29.5 bits (63), Expect = 2.6
 Identities = 14/47 (29%), Positives = 26/47 (55%)
 Frame = +3

Query: 363 NNRPHKIDGRIVEPKRAVPREEIKRPEASATVKKLFVAGLKQDIEEE 503
           + +P  +DGR+V  K+A P   +K P +   +     +GL ++I E+
Sbjct: 409 DTKPPFLDGRVVYTKQAEPVMPVKDPTSDMAIISRKGSGLVKEIREK 455


>At3g10845.1 68416.m01306 RNA recognition motif (RRM)-containing
           protein similar to SP|P42731 Polyadenylate-binding
           protein 2 (Poly(A) binding protein 2) (PABP 2)
           {Arabidopsis thaliana}; contains INTERPRO:IPR000504
           RNA-binding region RNP-1 (RNA recognition motif) domain
          Length = 423

 Score = 29.1 bits (62), Expect = 3.4
 Identities = 15/56 (26%), Positives = 31/56 (55%)
 Frame = +2

Query: 500 RRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQIKRFN 667
           +R+  +F  F  +V V ++ D ++GK  G G+ EF   +  ++   Q+N +  R++
Sbjct: 311 QRMLYFFQDF-EVVRVRLIVD-QSGKHMGCGYFEFASANEAEKALEQRNGKSLRYH 364


>At1g72800.1 68414.m08416 nuM1-related contains similarity with nuM1
           GI:1279563 from [Medicago sativa]
          Length = 335

 Score = 29.1 bits (62), Expect = 3.4
 Identities = 12/35 (34%), Positives = 19/35 (54%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDD 610
           L +YFS+FG I  V V     TG   G+ +++  +
Sbjct: 254 LSKYFSSFGEITRVFVPPSHGTGGSLGYAYIDLKE 288


>At1g41855.1 68414.m04833 hypothetical protein
          Length = 261

 Score = 29.1 bits (62), Expect = 3.4
 Identities = 13/44 (29%), Positives = 24/44 (54%), Gaps = 1/44 (2%)
 Frame = +3

Query: 291 PKTKRSKGFGFITYSQAHMVDEAQNNRPH-KIDGRIVEPKRAVP 419
           P+ K  KGFG +    + + +E++N +PH +  GR+     + P
Sbjct: 13  PELKNVKGFGDLELLASKLEEESRNQKPHTRPPGRVHPAPHSTP 56


>At4g00830.1 68417.m00114 RNA recognition motif (RRM)-containing
           protein similar to nucleolin protein; contains InterPro
           entry IPR000504: RNA-binding region RNP-1 (RNA
           recognition motif) (RRM)
          Length = 495

 Score = 28.7 bits (61), Expect = 4.5
 Identities = 12/34 (35%), Positives = 20/34 (58%)
 Frame = +3

Query: 258 GEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEA 359
           GEI +V +MKD  +  SKG+ F+ +    +  +A
Sbjct: 140 GEIFEVRLMKDRDSGDSKGYAFVAFKTKDVAQKA 173


>At3g52660.1 68416.m05801 RNA recognition motif (RRM)-containing
           protein heterogeneous nuclear ribonucleoprotein R, Homo
           sapiens, PIR:T02673; contains InterPro entry IPR000504:
           RNA-binding region RNP-1 (RNA recognition motif) (RRM)
          Length = 471

 Score = 28.7 bits (61), Expect = 4.5
 Identities = 10/34 (29%), Positives = 20/34 (58%)
 Frame = +3

Query: 258 GEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEA 359
           GE+ +V +M++  +   KG+ F+T+    +  EA
Sbjct: 116 GEVTEVRIMREKDSGDGKGYAFVTFRSKDLAAEA 149


>At4g38440.1 68417.m05432 expressed protein
          Length = 1465

 Score = 28.3 bits (60), Expect = 5.9
 Identities = 17/36 (47%), Positives = 20/36 (55%)
 Frame = +2

Query: 473 SWTEARH*RRRLREYFSTFGNIVSVSVVTDKETGKK 580
           +WTE     R LR  FS  GN+V   VV+  ETG K
Sbjct: 308 AWTERVEAARDLR--FSFDGNVVEEDVVSPAETGGK 341


>At4g30150.1 68417.m04287 expressed protein
          Length = 2009

 Score = 28.3 bits (60), Expect = 5.9
 Identities = 18/64 (28%), Positives = 29/64 (45%)
 Frame = -2

Query: 228  ICGSIVESTDKKFTCXXXXXXXXXXXXRLHI*YLLDLSPKMLIIN*ELDFSLIC*VFVSA 49
            +CG +VE++D K                L + +LL  S  +L +N ++D       FVS 
Sbjct: 1477 VCGDVVETSDVKKKIIESLIKGDSSEVVLALKHLLIASAAILRLNLQIDGITFSPTFVSV 1536

Query: 48   VLNI 37
            + NI
Sbjct: 1537 LTNI 1540


>At1g56660.1 68414.m06516 expressed protein
          Length = 522

 Score = 28.3 bits (60), Expect = 5.9
 Identities = 24/105 (22%), Positives = 45/105 (42%), Gaps = 6/105 (5%)
 Frame = +3

Query: 285 KDPKTKRSKGFGFITYSQAHMVDE-AQNNRPHKIDGRIVEPKRAVPREEIKRPEASATVK 461
           K+ K  + K    ++  +  + +E  + N+  + D    E K+  P++E K+ E S + +
Sbjct: 149 KNKKADKEKKHEDVSQEKEELEEEDGKKNKKKEKDESGTEEKKKKPKKEKKQKEESKSNE 208

Query: 462 KLFVAGLKQ-----DIEEEDLESXXXXXXXXXXXXXXQIKKQERK 581
              V G K+     D+E+ED E                 KK ++K
Sbjct: 209 DKKVKGKKEKGEKGDLEKEDEEKKKEHDETDQEMKEKDSKKNKKK 253


>At1g02840.3 68414.m00246 pre-mRNA splicing factor SF2 (SF2) / SR1
           protein identical to SP|O22315 Pre-mRNA splicing factor
           SF2 (SR1 protein) {Arabidopsis thaliana}
          Length = 303

 Score = 28.3 bits (60), Expect = 5.9
 Identities = 13/37 (35%), Positives = 21/37 (56%)
 Frame = +2

Query: 500 RRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDD 610
           R + + FS +G +V + +   K   +  G+ FVEFDD
Sbjct: 21  REVEDLFSKYGPVVQIDL---KVPPRPPGYAFVEFDD 54


>At1g02840.2 68414.m00244 pre-mRNA splicing factor SF2 (SF2) / SR1
           protein identical to SP|O22315 Pre-mRNA splicing factor
           SF2 (SR1 protein) {Arabidopsis thaliana}
          Length = 285

 Score = 28.3 bits (60), Expect = 5.9
 Identities = 13/37 (35%), Positives = 21/37 (56%)
 Frame = +2

Query: 500 RRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDD 610
           R + + FS +G +V + +   K   +  G+ FVEFDD
Sbjct: 21  REVEDLFSKYGPVVQIDL---KVPPRPPGYAFVEFDD 54


>At1g02840.1 68414.m00245 pre-mRNA splicing factor SF2 (SF2) / SR1
           protein identical to SP|O22315 Pre-mRNA splicing factor
           SF2 (SR1 protein) {Arabidopsis thaliana}
          Length = 303

 Score = 28.3 bits (60), Expect = 5.9
 Identities = 13/37 (35%), Positives = 21/37 (56%)
 Frame = +2

Query: 500 RRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDD 610
           R + + FS +G +V + +   K   +  G+ FVEFDD
Sbjct: 21  REVEDLFSKYGPVVQIDL---KVPPRPPGYAFVEFDD 54


>At4g35785.2 68417.m05083 transformer serine/arginine-rich
           ribonucleoprotein, putative similar to transformer-SR
           ribonucleoprotein [Nicotiana tabacum]
           gi|1781299|emb|CAA70700
          Length = 141

 Score = 27.9 bits (59), Expect = 7.8
 Identities = 9/26 (34%), Positives = 18/26 (69%)
 Frame = +3

Query: 258 GEIVDVVVMKDPKTKRSKGFGFITYS 335
           G++    ++ +P+T+ S+GF F+T S
Sbjct: 96  GKVASCFLVMEPRTRVSRGFAFVTMS 121


>At4g35785.1 68417.m05082 transformer serine/arginine-rich
           ribonucleoprotein, putative similar to transformer-SR
           ribonucleoprotein [Nicotiana tabacum]
           gi|1781299|emb|CAA70700
          Length = 140

 Score = 27.9 bits (59), Expect = 7.8
 Identities = 9/26 (34%), Positives = 18/26 (69%)
 Frame = +3

Query: 258 GEIVDVVVMKDPKTKRSKGFGFITYS 335
           G++    ++ +P+T+ S+GF F+T S
Sbjct: 95  GKVASCFLVMEPRTRVSRGFAFVTMS 120


>At1g79100.1 68414.m09223 arginine/serine-rich protein-related
           similar to arginine/serine-rich protein [Arabidopsis
           thaliana] GI:6601502
          Length = 70

 Score = 27.9 bits (59), Expect = 7.8
 Identities = 11/34 (32%), Positives = 18/34 (52%)
 Frame = +2

Query: 503 RLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEF 604
           ++R +   FG I+ V +  D+     RG  +VEF
Sbjct: 3   KIRVFRGDFGEIIHVQLAIDRAANLSRGDAYVEF 36


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 15,118,340
Number of Sequences: 28952
Number of extensions: 295392
Number of successful extensions: 1275
Number of sequences better than 10.0: 177
Number of HSP's better than 10.0 without gapping: 877
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1256
length of database: 12,070,560
effective HSP length: 79
effective length of database: 9,783,352
effective search space used: 1712086600
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).