SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS30010
         (545 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At3g51850.1 68416.m05686 calcium-dependent protein kinase, putat...    27   6.2  
At1g24340.1 68414.m03070 monooxygenase family protein similar to...    27   8.2  

>At3g51850.1 68416.m05686 calcium-dependent protein kinase, putative
           / CDPK, putative similar to calcium-dependent protein
           kinase [Arabidopsis thaliana] gi|836942|gb|AAA67655;
           contains protein kinase domain, Pfam:PF00069; contains
           EF hand domain (calcium-binding EF-hand), Pfam:PF00036,
           INTERPRO:IPR002048
          Length = 528

 Score = 27.5 bits (58), Expect = 6.2
 Identities = 14/37 (37%), Positives = 22/37 (59%), Gaps = 1/37 (2%)
 Frame = -1

Query: 452 ILYDELASYRRR-TDPKRPDLHYSISNFNYSAIELLK 345
           I Y+E A+  +  TD ++   HYS   FN  +I+L+K
Sbjct: 483 ISYEEFAAMMKTGTDWRKASRHYSRGRFNSLSIKLMK 519


>At1g24340.1 68414.m03070 monooxygenase family protein similar to
           polyketide hydroxylases from several bacterial species;
           contains Pfam:PF01360 [Monooxygenase]
          Length = 707

 Score = 27.1 bits (57), Expect = 8.2
 Identities = 17/55 (30%), Positives = 26/55 (47%), Gaps = 7/55 (12%)
 Frame = -1

Query: 476 CFRRHCRAILYD------ELASYRRRTDPKR-PDLHYSISNFNYSAIELLKVALR 333
           C RRHCR++ YD           R R  PK+ P   +    F++S + +L +  R
Sbjct: 37  CLRRHCRSLEYDFSFLKPLYKVERERNHPKQGPSSDFQGLRFSFSTMAILGLIKR 91


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 11,026,078
Number of Sequences: 28952
Number of extensions: 212116
Number of successful extensions: 401
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 395
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 401
length of database: 12,070,560
effective HSP length: 77
effective length of database: 9,841,256
effective search space used: 1023490624
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).