SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS30008
         (465 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At2g34250.1 68415.m04190 protein transport protein sec61, putati...    60   1e-09
At1g29310.1 68414.m03583 protein transport protein sec61, putati...    60   1e-09
At1g78720.1 68414.m09175 protein transport protein sec61, putati...    58   2e-09
At1g31910.1 68414.m03921 GHMP kinase family protein contains TIG...    32   0.22 
At3g15720.1 68416.m01992 glycoside hydrolase family 28 protein /...    29   2.0  
At5g18360.1 68418.m02160 disease resistance protein (TIR-NBS-LRR...    27   4.7  
At4g39753.1 68417.m05629 kelch repeat-containing F-box family pr...    27   4.7  
At4g36850.1 68417.m05225 PQ-loop repeat family protein / transme...    27   4.7  
At5g65930.2 68418.m08300 kinesin-like calmodulin-binding protein...    27   6.2  
At5g65930.1 68418.m08299 kinesin-like calmodulin-binding protein...    27   6.2  
At5g22355.1 68418.m02608 DC1 domain-containing protein contains ...    27   6.2  
At4g36280.1 68417.m05159 ATP-binding region, ATPase-like domain-...    27   8.3  
At4g00150.1 68417.m00015 scarecrow-like transcription factor 6 (...    27   8.3  

>At2g34250.1 68415.m04190 protein transport protein sec61, putative
           similar to PfSec61 [Plasmodium falciparum] GI:3057044;
           contains Pfam profile PF00344: eubacterial secY protein
          Length = 475

 Score = 59.7 bits (138), Expect = 1e-09
 Identities = 26/29 (89%), Positives = 29/29 (100%)
 Frame = +3

Query: 3   YIPTAAAFGGLCIGALSVLADFLGAIGSG 89
           YIPTAAAFGG+CIGAL+VLADF+GAIGSG
Sbjct: 417 YIPTAAAFGGVCIGALTVLADFMGAIGSG 445



 Score = 45.2 bits (102), Expect = 2e-05
 Identities = 23/32 (71%), Positives = 25/32 (78%), Gaps = 1/32 (3%)
 Frame = +1

Query: 73  GPSAPGTGILLAVTIIYQYFEIFVKEQA-EMG 165
           G    GTGILLAVTIIYQYFE F KE+A E+G
Sbjct: 440 GAIGSGTGILLAVTIIYQYFETFEKEKASELG 471


>At1g29310.1 68414.m03583 protein transport protein sec61, putative
           similar to PfSec61 [Plasmodium falciparum] GI:3057044;
           contains Pfam profile PF00344: eubacterial secY protein
          Length = 475

 Score = 59.7 bits (138), Expect = 1e-09
 Identities = 26/29 (89%), Positives = 29/29 (100%)
 Frame = +3

Query: 3   YIPTAAAFGGLCIGALSVLADFLGAIGSG 89
           YIPTAAAFGG+CIGAL+VLADF+GAIGSG
Sbjct: 417 YIPTAAAFGGVCIGALTVLADFMGAIGSG 445



 Score = 45.2 bits (102), Expect = 2e-05
 Identities = 23/32 (71%), Positives = 25/32 (78%), Gaps = 1/32 (3%)
 Frame = +1

Query: 73  GPSAPGTGILLAVTIIYQYFEIFVKEQA-EMG 165
           G    GTGILLAVTIIYQYFE F KE+A E+G
Sbjct: 440 GAIGSGTGILLAVTIIYQYFETFEKEKASELG 471


>At1g78720.1 68414.m09175 protein transport protein sec61, putative
           similar to SP|P38377 Protein transport protein Sec61
           alpha subunit isoform 1 (Sec61 alpha- 1) {Canis
           familiaris}; contains Pfam profile PF00344: eubacterial
           secY protein
          Length = 475

 Score = 58.4 bits (135), Expect = 2e-09
 Identities = 26/29 (89%), Positives = 28/29 (96%)
 Frame = +3

Query: 3   YIPTAAAFGGLCIGALSVLADFLGAIGSG 89
           YIPTAAAFGGLCIGAL+VLAD +GAIGSG
Sbjct: 417 YIPTAAAFGGLCIGALTVLADLMGAIGSG 445



 Score = 45.2 bits (102), Expect = 2e-05
 Identities = 23/32 (71%), Positives = 25/32 (78%), Gaps = 1/32 (3%)
 Frame = +1

Query: 73  GPSAPGTGILLAVTIIYQYFEIFVKEQA-EMG 165
           G    GTGILLAVTIIYQYFE F KE+A E+G
Sbjct: 440 GAIGSGTGILLAVTIIYQYFETFEKEKASELG 471


>At1g31910.1 68414.m03921 GHMP kinase family protein contains
           TIGRFAM profile TIGR01219: phosphomevalonate kinase;
           contains Pfam PF00288: GHMP kinases putative ATP-binding
           protein domain; similar to Phosphomevalonate kinase (EC
           2.7.4.2) (Swiss-Prot:P24521) [Saccharomyces cerevisiae]
          Length = 505

 Score = 31.9 bits (69), Expect = 0.22
 Identities = 18/65 (27%), Positives = 28/65 (43%)
 Frame = +3

Query: 3   YIPTAAAFGGLCIGALSVLADFLGAIGSGHWDTARRHHHLPVLRDLCQGTSGDGRHEHTA 182
           + P   +F  + +  L  L + +G I  G WD  R    LP L +L  G  G G     +
Sbjct: 256 FSPEVLSFAQVAVTGLP-LNEVIGTILKGKWDNKRTEFSLPPLMNLFLGEPGSGGSSTPS 314

Query: 183 LLSLV 197
           ++  V
Sbjct: 315 MVGAV 319


>At3g15720.1 68416.m01992 glycoside hydrolase family 28 protein /
           polygalacturonase (pectinase) family protein similar to
           polygalacturonase [Cucumis sativus] GI:6624205; contains
           Pfam profile PF00295: Glycosyl hydrolases family 28
           (polygalacturonases)
          Length = 456

 Score = 28.7 bits (61), Expect = 2.0
 Identities = 19/40 (47%), Positives = 22/40 (55%), Gaps = 2/40 (5%)
 Frame = -1

Query: 138 DLEVLVNDGDGEQYPSARSRWP-RGSRP-ALTEPRCTVLR 25
           D+E LV +GDGE      S W  +GSRP AL    C  LR
Sbjct: 111 DIEGLVIEGDGEINGQGSSWWEHKGSRPTALKFRSCNNLR 150


>At5g18360.1 68418.m02160 disease resistance protein (TIR-NBS-LRR
           class), putative domain signature TIR-NBS-LRR exists,
           suggestive of a disease resistance protein.
          Length = 900

 Score = 27.5 bits (58), Expect = 4.7
 Identities = 15/34 (44%), Positives = 23/34 (67%), Gaps = 1/34 (2%)
 Frame = +1

Query: 88  GTGILLAVTI-IYQYFEIFVKEQAEMGGMSTLLF 186
           GTG +L +++ I +  E+F+ E+A  GGM  LLF
Sbjct: 527 GTGAVLGISLDISKINELFLNERA-FGGMHNLLF 559


>At4g39753.1 68417.m05629 kelch repeat-containing F-box family
           protein contains F-box domain Pfam:PF00646 and Kelch
           motif Pfam:PF01344
          Length = 390

 Score = 27.5 bits (58), Expect = 4.7
 Identities = 10/30 (33%), Positives = 15/30 (50%)
 Frame = -1

Query: 120 NDGDGEQYPSARSRWPRGSRPALTEPRCTV 31
           ND     Y   R +W   ++P L + RC+V
Sbjct: 250 NDSKDSVYDPIREKWNVAAKPQLNDSRCSV 279


>At4g36850.1 68417.m05225 PQ-loop repeat family protein /
           transmembrane family protein similar to SP|Q10482 Seven
           transmembrane protein 1 {Schizosaccharomyces pombe};
           contains Pfam profile PF04193: PQ loop repeat
          Length = 374

 Score = 27.5 bits (58), Expect = 4.7
 Identities = 14/35 (40%), Positives = 21/35 (60%)
 Frame = -1

Query: 234 TELNAAVRLPLSLRDLEEQCAHAAHLRLFLDKDLE 130
           T L A+  LPL  + L E+ AHA+  RL  ++ +E
Sbjct: 220 TFLAASASLPLQAKSLAEKYAHASSRRLLNERIVE 254


>At5g65930.2 68418.m08300 kinesin-like calmodulin-binding protein
            (ZWICHEL) identical to kinesin-like protein GI:2224925
            from [Arabidopsis thaliana]
          Length = 1260

 Score = 27.1 bits (57), Expect = 6.2
 Identities = 12/29 (41%), Positives = 18/29 (62%)
 Frame = +3

Query: 45   ALSVLADFLGAIGSGHWDTARRHHHLPVL 131
            +LS L D +GA+ SG+     R+H L +L
Sbjct: 1141 SLSALGDVIGALSSGNQHIPYRNHKLTML 1169


>At5g65930.1 68418.m08299 kinesin-like calmodulin-binding protein
            (ZWICHEL) identical to kinesin-like protein GI:2224925
            from [Arabidopsis thaliana]
          Length = 1259

 Score = 27.1 bits (57), Expect = 6.2
 Identities = 12/29 (41%), Positives = 18/29 (62%)
 Frame = +3

Query: 45   ALSVLADFLGAIGSGHWDTARRHHHLPVL 131
            +LS L D +GA+ SG+     R+H L +L
Sbjct: 1140 SLSALGDVIGALSSGNQHIPYRNHKLTML 1168


>At5g22355.1 68418.m02608 DC1 domain-containing protein contains
           Pfam PF03107: DC1 domain; similar to ULI3 [Arabidopsis
           thaliana] GI:17225050
          Length = 664

 Score = 27.1 bits (57), Expect = 6.2
 Identities = 15/47 (31%), Positives = 23/47 (48%), Gaps = 1/47 (2%)
 Frame = -3

Query: 445 KFISY-KLAHHPRTRRHAHNTTPVGALPSTQQILNLKSNFFDKVQRC 308
           +FI + K A+HP+ +RH  +T P        +  + K   F  V RC
Sbjct: 417 RFILHEKCANHPKKKRHVFHTKPFTLWSRPPRTFHSKDFRFYDVFRC 463


>At4g36280.1 68417.m05159 ATP-binding region, ATPase-like
           domain-containing protein low similarity to microrchidia
           [Mus musculus] GI:5410255; contains Pfam profile
           PF02518: ATPase, histidine kinase-, DNA gyrase B-, and
           HSP90-like domain protein
          Length = 626

 Score = 26.6 bits (56), Expect = 8.3
 Identities = 18/49 (36%), Positives = 24/49 (48%)
 Frame = -1

Query: 288 RYENVHLMMSIRAETTIKTELNAAVRLPLSLRDLEEQCAHAAHLRLFLD 142
           R EN+ L M  R E  IK E      +    ++LEE  +  AHL L +D
Sbjct: 571 RQENLQLFM--RCEEYIKKENETEQTVKSLEKELEEFKSKCAHLALLVD 617


>At4g00150.1 68417.m00015 scarecrow-like transcription factor 6
           (SCL6)
          Length = 558

 Score = 26.6 bits (56), Expect = 8.3
 Identities = 14/39 (35%), Positives = 18/39 (46%)
 Frame = +3

Query: 72  GAIGSGHWDTARRHHHLPVLRDLCQGTSGDGRHEHTALL 188
           GAIG G W+    H H   +  L  G S D   E  ++L
Sbjct: 91  GAIGLGDWEEQVPHDHEQSILGLIMGDSTDPSLELNSIL 129


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 10,038,422
Number of Sequences: 28952
Number of extensions: 201458
Number of successful extensions: 625
Number of sequences better than 10.0: 13
Number of HSP's better than 10.0 without gapping: 604
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 625
length of database: 12,070,560
effective HSP length: 75
effective length of database: 9,899,160
effective search space used: 782033640
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).