SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS30001
         (833 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At3g54010.2 68416.m05972 peptidyl-prolyl cis-trans isomerase, pu...    31   1.2  
At3g54010.1 68416.m05971 peptidyl-prolyl cis-trans isomerase, pu...    31   1.2  
At5g16710.1 68418.m01956 dehydroascorbate reductase, putative St...    29   5.0  
At2g41680.1 68415.m05149 thioredoxin reductase, putative / NADPH...    29   5.0  
At3g60470.1 68416.m06763 hypothetical protein contains Pfam prof...    28   6.6  

>At3g54010.2 68416.m05972 peptidyl-prolyl cis-trans isomerase,
           putative / FK506-binding protein, putative / pasticcino
           1-D (PAS1-D) nearly identical to pasticcino 1-D
           [Arabidopsis thaliana] GI:3080740
          Length = 545

 Score = 30.7 bits (66), Expect = 1.2
 Identities = 21/64 (32%), Positives = 33/64 (51%), Gaps = 8/64 (12%)
 Frame = -3

Query: 423 MQAKLEDLRISAEKRGLRINTNKTV--DMRVMSKNTTPLK------LQDCGFEVSTEVYI 268
           M   L+D R+S   +G+ +N  KTV  D ++   N  PL+      L   GFE+ T + +
Sbjct: 195 MDCPLQDSRLSVHYKGMLLNEEKTVFYDSKI-DNNDQPLEFSSGEGLVPEGFEMCTRLML 253

Query: 267 SGEL 256
            GE+
Sbjct: 254 PGEI 257


>At3g54010.1 68416.m05971 peptidyl-prolyl cis-trans isomerase,
           putative / FK506-binding protein, putative / pasticcino
           1-D (PAS1-D) nearly identical to pasticcino 1-D
           [Arabidopsis thaliana] GI:3080740
          Length = 635

 Score = 30.7 bits (66), Expect = 1.2
 Identities = 21/64 (32%), Positives = 33/64 (51%), Gaps = 8/64 (12%)
 Frame = -3

Query: 423 MQAKLEDLRISAEKRGLRINTNKTV--DMRVMSKNTTPLK------LQDCGFEVSTEVYI 268
           M   L+D R+S   +G+ +N  KTV  D ++   N  PL+      L   GFE+ T + +
Sbjct: 285 MDCPLQDSRLSVHYKGMLLNEEKTVFYDSKI-DNNDQPLEFSSGEGLVPEGFEMCTRLML 343

Query: 267 SGEL 256
            GE+
Sbjct: 344 PGEI 347


>At5g16710.1 68418.m01956 dehydroascorbate reductase, putative
           Strong similarity to dehydroascorbate reductase
           [Spinacia oleracea] gi:10952512 gb:AAG24945
          Length = 258

 Score = 28.7 bits (61), Expect = 5.0
 Identities = 13/28 (46%), Positives = 15/28 (53%)
 Frame = -1

Query: 380 EACVLTPTKLSTCE*CQKTLLP*SSKTV 297
           +A + TP KL  C  CQK LL    K V
Sbjct: 54  KASITTPNKLGDCPFCQKVLLTMEEKNV 81


>At2g41680.1 68415.m05149 thioredoxin reductase, putative /
           NADPH-dependent thioredoxin reductase, putative The last
           2 exons encode thioredoxin. There is an EST match to
           exons 5-7, and the distance between exon 7 and exon 8 is
           only 90bp. It is unlikely this is two separate genes,
           but more likely a hybrid protein.
          Length = 529

 Score = 28.7 bits (61), Expect = 5.0
 Identities = 10/24 (41%), Positives = 15/24 (62%)
 Frame = -1

Query: 746 VLTLYSGAKCGPCLKQRGIPNKII 675
           +L LY+   CGPC   + I NK++
Sbjct: 445 ILVLYTSPTCGPCRTLKPILNKVV 468


>At3g60470.1 68416.m06763 hypothetical protein contains Pfam profile
           PF03140: Plant protein of unknown function
          Length = 540

 Score = 28.3 bits (60), Expect = 6.6
 Identities = 13/38 (34%), Positives = 23/38 (60%)
 Frame = -2

Query: 718 VDPA*NKEVYQIKSLV*SRPYTEVVHVESCMTKSWEPL 605
           VD   +  V+ I+ L+ S+ YT +    SC+ K+W+P+
Sbjct: 137 VDMILHDSVFIIEFLLRSKDYTLLEDQGSCIKKTWDPI 174


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 19,165,854
Number of Sequences: 28952
Number of extensions: 418798
Number of successful extensions: 992
Number of sequences better than 10.0: 5
Number of HSP's better than 10.0 without gapping: 966
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 992
length of database: 12,070,560
effective HSP length: 80
effective length of database: 9,754,400
effective search space used: 1921616800
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).