SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= tesS0036
         (648 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At4g20890.1 68417.m03029 tubulin beta-9 chain (TUB9) nearly iden...   179   1e-45
At1g20010.1 68414.m02506 tubulin beta-5 chain (TUB5) nearly iden...   179   1e-45
At1g75780.1 68414.m08801 tubulin beta-1 chain (TUB1) nearly iden...   178   3e-45
At2g29550.1 68415.m03589 tubulin beta-7 chain (TUB7) identical t...   175   2e-44
At5g23860.1 68418.m02801 tubulin beta-8 chain (TUB8) (TUBB8) ide...   174   5e-44
At5g44340.1 68418.m05429 tubulin beta-4 chain (TUB4) nearly iden...   173   8e-44
At5g12250.1 68418.m01439 tubulin beta-6 chain (TUB6) nearly iden...   173   1e-43
At5g62700.1 68418.m07868 tubulin beta-2/beta-3 chain (TUB3) near...   171   3e-43
At5g62690.1 68418.m07867 tubulin beta-2/beta-3 chain (TUB2) near...   171   3e-43
At5g19780.1 68418.m02351 tubulin alpha-3/alpha-5 chain (TUA5) ne...    97   1e-20
At5g19770.1 68418.m02350 tubulin alpha-3/alpha-5 chain (TUA3) ne...    97   1e-20
At4g14960.2 68417.m02299 tubulin alpha-6 chain (TUA6) nearly ide...    96   2e-20
At4g14960.1 68417.m02298 tubulin alpha-6 chain (TUA6) nearly ide...    96   2e-20
At1g50010.1 68414.m05612 tubulin alpha-2/alpha-4 chain (TUA2) id...    96   2e-20
At1g04820.1 68414.m00478 tubulin alpha-2/alpha-4 chain (TUA4) ne...    96   2e-20
At1g64740.1 68414.m07340 tubulin alpha-1 chain (TUA1) nearly ide...    94   8e-20
At5g05620.1 68418.m00612 tubulin gamma-2 chain / gamma-2 tubulin...    69   2e-12
At3g61650.1 68416.m06909 tubulin gamma-1 chain / gamma-1 tubulin...    69   3e-12
At4g37190.1 68417.m05265 expressed protein                             30   1.2  
At3g10900.1 68416.m01312 (1-4)-beta-mannan endohydrolase, putati...    29   2.0  
At2g31580.1 68415.m03858 expressed protein   contains Pfam profi...    29   2.0  
At2g26850.1 68415.m03221 F-box family protein contains Pfam PF00...    29   2.0  
At3g24550.1 68416.m03083 protein kinase family protein contains ...    29   2.7  
At1g69500.1 68414.m07986 cytochrome P450 family protein similar ...    27   8.1  
At1g54970.1 68414.m06278 proline-rich family protein similar to ...    27   8.1  
At1g53300.1 68414.m06041 thioredoxin family protein contains Pfa...    27   8.1  

>At4g20890.1 68417.m03029 tubulin beta-9 chain (TUB9) nearly
           identical to SP|P29517 Tubulin beta-9 chain {Arabidopsis
           thaliana}
          Length = 444

 Score =  179 bits (436), Expect = 1e-45
 Identities = 79/88 (89%), Positives = 85/88 (96%)
 Frame = +2

Query: 257 RINVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH 436
           RINVY+NEASGGKYVPRAV++DLEPGTMDS+RSGPFGQIFRPDNFVFGQSGAGNNWAKGH
Sbjct: 46  RINVYFNEASGGKYVPRAVLMDLEPGTMDSLRSGPFGQIFRPDNFVFGQSGAGNNWAKGH 105

Query: 437 YTEGAELVDSVLDVVRKEAEGCDCCRVF 520
           YTEGAEL+DSVLDVVRKEAE CDC + F
Sbjct: 106 YTEGAELIDSVLDVVRKEAENCDCLQGF 133



 Score = 79.8 bits (188), Expect = 1e-15
 Identities = 35/44 (79%), Positives = 37/44 (84%)
 Frame = +3

Query: 123 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDLQL 254
           MREI+HIQ GQCGNQIGAKFWEVI  EHGID TG   GD+DLQL
Sbjct: 1   MREILHIQGGQCGNQIGAKFWEVICGEHGIDQTGQSCGDTDLQL 44



 Score = 39.9 bits (89), Expect = 0.001
 Identities = 21/44 (47%), Positives = 22/44 (50%)
 Frame = +1

Query: 511 QGFQXXXXXXXXXXXXXXXXXXXKIREEYPDRIMNTFSVVPSSK 642
           QGFQ                   KIREEYPDR+M TFSV PS K
Sbjct: 131 QGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMMTFSVFPSPK 174


>At1g20010.1 68414.m02506 tubulin beta-5 chain (TUB5) nearly
           identical to SP|P29513 Tubulin beta-5 chain {Arabidopsis
           thaliana}
          Length = 449

 Score =  179 bits (436), Expect = 1e-45
 Identities = 78/88 (88%), Positives = 85/88 (96%)
 Frame = +2

Query: 257 RINVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH 436
           RINVYYNEASGG+YVPRAV++DLEPGTMDS+RSGPFGQIFRPDNFVFGQSGAGNNWAKGH
Sbjct: 47  RINVYYNEASGGRYVPRAVLMDLEPGTMDSIRSGPFGQIFRPDNFVFGQSGAGNNWAKGH 106

Query: 437 YTEGAELVDSVLDVVRKEAEGCDCCRVF 520
           YTEGAEL+D+VLDVVRKEAE CDC + F
Sbjct: 107 YTEGAELIDAVLDVVRKEAENCDCLQGF 134



 Score = 83.4 bits (197), Expect = 1e-16
 Identities = 37/45 (82%), Positives = 41/45 (91%), Gaps = 1/45 (2%)
 Frame = +3

Query: 123 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGD-SDLQL 254
           MREI+HIQ GQCGNQIG+KFWEVI DEHGID+TG YSGD +DLQL
Sbjct: 1   MREILHIQGGQCGNQIGSKFWEVICDEHGIDSTGRYSGDTADLQL 45



 Score = 39.5 bits (88), Expect = 0.002
 Identities = 21/44 (47%), Positives = 22/44 (50%)
 Frame = +1

Query: 511 QGFQXXXXXXXXXXXXXXXXXXXKIREEYPDRIMNTFSVVPSSK 642
           QGFQ                   KIREEYPDR+M TFSV PS K
Sbjct: 132 QGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLTFSVFPSPK 175


>At1g75780.1 68414.m08801 tubulin beta-1 chain (TUB1) nearly
           identical to SP|P12411 Tubulin beta-1 chain {Arabidopsis
           thaliana}
          Length = 447

 Score =  178 bits (433), Expect = 3e-45
 Identities = 77/88 (87%), Positives = 85/88 (96%)
 Frame = +2

Query: 257 RINVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH 436
           RINVYYNEASGG+YVPRAV++DLEPGTMDS+RSGP+GQIFRPDNFVFGQSGAGNNWAKGH
Sbjct: 47  RINVYYNEASGGRYVPRAVLMDLEPGTMDSIRSGPYGQIFRPDNFVFGQSGAGNNWAKGH 106

Query: 437 YTEGAELVDSVLDVVRKEAEGCDCCRVF 520
           YTEGAEL+D+VLDVVRKEAE CDC + F
Sbjct: 107 YTEGAELIDAVLDVVRKEAENCDCLQGF 134



 Score = 81.8 bits (193), Expect = 4e-16
 Identities = 35/45 (77%), Positives = 40/45 (88%), Gaps = 1/45 (2%)
 Frame = +3

Query: 123 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDS-DLQL 254
           MREI+H+Q GQCGNQIG+KFWEVI DEHG+D TG Y+GDS DLQL
Sbjct: 1   MREILHVQGGQCGNQIGSKFWEVICDEHGVDPTGRYNGDSADLQL 45



 Score = 39.5 bits (88), Expect = 0.002
 Identities = 21/44 (47%), Positives = 22/44 (50%)
 Frame = +1

Query: 511 QGFQXXXXXXXXXXXXXXXXXXXKIREEYPDRIMNTFSVVPSSK 642
           QGFQ                   KIREEYPDR+M TFSV PS K
Sbjct: 132 QGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLTFSVFPSPK 175


>At2g29550.1 68415.m03589 tubulin beta-7 chain (TUB7) identical to
           GB:M84704 SP|P29515 Tubulin beta-7 chain {Arabidopsis
           thaliana}
          Length = 449

 Score =  175 bits (427), Expect = 2e-44
 Identities = 77/88 (87%), Positives = 84/88 (95%)
 Frame = +2

Query: 257 RINVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH 436
           R+NVYYNEAS G+YVPRAV++DLEPGTMDSVRSGP+GQIFRPDNFVFGQSGAGNNWAKGH
Sbjct: 46  RVNVYYNEASCGRYVPRAVLMDLEPGTMDSVRSGPYGQIFRPDNFVFGQSGAGNNWAKGH 105

Query: 437 YTEGAELVDSVLDVVRKEAEGCDCCRVF 520
           YTEGAEL+DSVLDVVRKEAE CDC + F
Sbjct: 106 YTEGAELIDSVLDVVRKEAENCDCLQGF 133



 Score = 80.6 bits (190), Expect = 8e-16
 Identities = 34/44 (77%), Positives = 39/44 (88%)
 Frame = +3

Query: 123 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDLQL 254
           MREI+HIQ GQCGNQIG+KFWEV++ EHGID TG Y GDS+LQL
Sbjct: 1   MREILHIQGGQCGNQIGSKFWEVVNLEHGIDQTGRYVGDSELQL 44



 Score = 39.9 bits (89), Expect = 0.001
 Identities = 21/44 (47%), Positives = 22/44 (50%)
 Frame = +1

Query: 511 QGFQXXXXXXXXXXXXXXXXXXXKIREEYPDRIMNTFSVVPSSK 642
           QGFQ                   KIREEYPDR+M TFSV PS K
Sbjct: 131 QGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMMTFSVFPSPK 174


>At5g23860.1 68418.m02801 tubulin beta-8 chain (TUB8) (TUBB8)
           identical to SP|P29516 Tubulin beta-8 chain {Arabidopsis
           thaliana}; supporting cDNA gi|15451225|gb|AY054693.1|
          Length = 449

 Score =  174 bits (423), Expect = 5e-44
 Identities = 76/88 (86%), Positives = 84/88 (95%)
 Frame = +2

Query: 257 RINVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH 436
           R+NVYYNEAS G++VPRAV++DLEPGTMDSVRSGP+GQIFRPDNFVFGQSGAGNNWAKGH
Sbjct: 46  RVNVYYNEASCGRFVPRAVLMDLEPGTMDSVRSGPYGQIFRPDNFVFGQSGAGNNWAKGH 105

Query: 437 YTEGAELVDSVLDVVRKEAEGCDCCRVF 520
           YTEGAEL+DSVLDVVRKEAE CDC + F
Sbjct: 106 YTEGAELIDSVLDVVRKEAENCDCLQGF 133



 Score = 82.2 bits (194), Expect = 3e-16
 Identities = 34/44 (77%), Positives = 39/44 (88%)
 Frame = +3

Query: 123 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDLQL 254
           MREI+HIQ GQCGNQIGAKFWEV+  EHGID+TG Y G++DLQL
Sbjct: 1   MREILHIQGGQCGNQIGAKFWEVVCAEHGIDSTGRYQGENDLQL 44



 Score = 39.5 bits (88), Expect = 0.002
 Identities = 21/44 (47%), Positives = 22/44 (50%)
 Frame = +1

Query: 511 QGFQXXXXXXXXXXXXXXXXXXXKIREEYPDRIMNTFSVVPSSK 642
           QGFQ                   KIREEYPDR+M TFSV PS K
Sbjct: 131 QGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLTFSVFPSPK 174


>At5g44340.1 68418.m05429 tubulin beta-4 chain (TUB4) nearly
           identical to SP|P24636 Tubulin beta-4 chain {Arabidopsis
           thaliana}
          Length = 444

 Score =  173 bits (421), Expect = 8e-44
 Identities = 77/88 (87%), Positives = 84/88 (95%)
 Frame = +2

Query: 257 RINVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH 436
           RI+VY+NEASGGKYVPRAV++DLEPGTMDS+RSGPFGQIFRPDNFVFGQSGAGNNWAKGH
Sbjct: 46  RIDVYFNEASGGKYVPRAVLMDLEPGTMDSLRSGPFGQIFRPDNFVFGQSGAGNNWAKGH 105

Query: 437 YTEGAELVDSVLDVVRKEAEGCDCCRVF 520
           YTEGAEL+DSVLDVVRKEAE  DC + F
Sbjct: 106 YTEGAELIDSVLDVVRKEAENSDCLQGF 133



 Score = 83.8 bits (198), Expect = 9e-17
 Identities = 37/44 (84%), Positives = 38/44 (86%)
 Frame = +3

Query: 123 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDLQL 254
           MREI+HIQ GQCGNQIGAKFWEVI DEHGID TG Y GDS LQL
Sbjct: 1   MREILHIQGGQCGNQIGAKFWEVICDEHGIDHTGQYVGDSPLQL 44



 Score = 39.9 bits (89), Expect = 0.001
 Identities = 21/44 (47%), Positives = 22/44 (50%)
 Frame = +1

Query: 511 QGFQXXXXXXXXXXXXXXXXXXXKIREEYPDRIMNTFSVVPSSK 642
           QGFQ                   KIREEYPDR+M TFSV PS K
Sbjct: 131 QGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMMTFSVFPSPK 174


>At5g12250.1 68418.m01439 tubulin beta-6 chain (TUB6) nearly
           identical to SP|P29514 Tubulin beta-6 chain {Arabidopsis
           thaliana}
          Length = 449

 Score =  173 bits (420), Expect = 1e-43
 Identities = 74/88 (84%), Positives = 84/88 (95%)
 Frame = +2

Query: 257 RINVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH 436
           R+NVYYNEAS G+YVPRA+++DLEPGTMDSVR+GP+GQIFRPDNFVFGQSGAGNNWAKGH
Sbjct: 46  RVNVYYNEASCGRYVPRAILMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGH 105

Query: 437 YTEGAELVDSVLDVVRKEAEGCDCCRVF 520
           YTEGAEL+D+VLDVVRKEAE CDC + F
Sbjct: 106 YTEGAELIDAVLDVVRKEAENCDCLQGF 133



 Score = 83.4 bits (197), Expect = 1e-16
 Identities = 35/44 (79%), Positives = 39/44 (88%)
 Frame = +3

Query: 123 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDLQL 254
           MREI+HIQ GQCGNQIG+KFWEV+ DEHGID TG Y G+SDLQL
Sbjct: 1   MREILHIQGGQCGNQIGSKFWEVVCDEHGIDPTGRYVGNSDLQL 44



 Score = 39.5 bits (88), Expect = 0.002
 Identities = 21/44 (47%), Positives = 22/44 (50%)
 Frame = +1

Query: 511 QGFQXXXXXXXXXXXXXXXXXXXKIREEYPDRIMNTFSVVPSSK 642
           QGFQ                   KIREEYPDR+M TFSV PS K
Sbjct: 131 QGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLTFSVFPSPK 174


>At5g62700.1 68418.m07868 tubulin beta-2/beta-3 chain (TUB3) nearly
           identical to SP|P29512 Tubulin beta-2/beta-3 chain
           {Arabidopsis thaliana}
          Length = 450

 Score =  171 bits (416), Expect = 3e-43
 Identities = 75/88 (85%), Positives = 83/88 (94%)
 Frame = +2

Query: 257 RINVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH 436
           RINVYYNEAS G++VPRAV++DLEPGTMDS+RSGP+GQ FRPDNFVFGQSGAGNNWAKGH
Sbjct: 46  RINVYYNEASCGRFVPRAVLMDLEPGTMDSLRSGPYGQTFRPDNFVFGQSGAGNNWAKGH 105

Query: 437 YTEGAELVDSVLDVVRKEAEGCDCCRVF 520
           YTEGAEL+DSVLDVVRKEAE CDC + F
Sbjct: 106 YTEGAELIDSVLDVVRKEAENCDCLQGF 133



 Score = 84.6 bits (200), Expect = 5e-17
 Identities = 36/44 (81%), Positives = 39/44 (88%)
 Frame = +3

Query: 123 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDLQL 254
           MREI+HIQ GQCGNQIGAKFWEV+  EHGID TG Y+GDSDLQL
Sbjct: 1   MREILHIQGGQCGNQIGAKFWEVVCAEHGIDPTGRYTGDSDLQL 44



 Score = 39.5 bits (88), Expect = 0.002
 Identities = 21/44 (47%), Positives = 22/44 (50%)
 Frame = +1

Query: 511 QGFQXXXXXXXXXXXXXXXXXXXKIREEYPDRIMNTFSVVPSSK 642
           QGFQ                   KIREEYPDR+M TFSV PS K
Sbjct: 131 QGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLTFSVFPSPK 174


>At5g62690.1 68418.m07867 tubulin beta-2/beta-3 chain (TUB2) nearly
           identical to SP|P29512 Tubulin beta-2/beta-3 chain
           {Arabidopsis thaliana}
          Length = 450

 Score =  171 bits (416), Expect = 3e-43
 Identities = 75/88 (85%), Positives = 83/88 (94%)
 Frame = +2

Query: 257 RINVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH 436
           RINVYYNEAS G++VPRAV++DLEPGTMDS+RSGP+GQ FRPDNFVFGQSGAGNNWAKGH
Sbjct: 46  RINVYYNEASCGRFVPRAVLMDLEPGTMDSLRSGPYGQTFRPDNFVFGQSGAGNNWAKGH 105

Query: 437 YTEGAELVDSVLDVVRKEAEGCDCCRVF 520
           YTEGAEL+DSVLDVVRKEAE CDC + F
Sbjct: 106 YTEGAELIDSVLDVVRKEAENCDCLQGF 133



 Score = 84.6 bits (200), Expect = 5e-17
 Identities = 36/44 (81%), Positives = 39/44 (88%)
 Frame = +3

Query: 123 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDLQL 254
           MREI+HIQ GQCGNQIGAKFWEV+  EHGID TG Y+GDSDLQL
Sbjct: 1   MREILHIQGGQCGNQIGAKFWEVVCAEHGIDPTGRYTGDSDLQL 44



 Score = 39.5 bits (88), Expect = 0.002
 Identities = 21/44 (47%), Positives = 22/44 (50%)
 Frame = +1

Query: 511 QGFQXXXXXXXXXXXXXXXXXXXKIREEYPDRIMNTFSVVPSSK 642
           QGFQ                   KIREEYPDR+M TFSV PS K
Sbjct: 131 QGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLTFSVFPSPK 174


>At5g19780.1 68418.m02351 tubulin alpha-3/alpha-5 chain (TUA5)
           nearly identical to SP|P20363 Tubulin alpha-3/alpha-5
           chain {Arabidopsis thaliana}
          Length = 450

 Score = 96.7 bits (230), Expect = 1e-20
 Identities = 41/80 (51%), Positives = 56/80 (70%)
 Frame = +2

Query: 263 NVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYT 442
           N +++E   GK+VPRAV VDLEP  +D VR+G + Q+F P+  + G+  A NN+A+GHYT
Sbjct: 50  NTFFSETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYT 109

Query: 443 EGAELVDSVLDVVRKEAEGC 502
            G E+VD  LD VRK A+ C
Sbjct: 110 VGKEIVDLCLDRVRKLADNC 129



 Score = 40.3 bits (90), Expect = 0.001
 Identities = 18/40 (45%), Positives = 22/40 (55%)
 Frame = +3

Query: 123 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDS 242
           MREI+ I  GQ G Q+G   WE+   EHGI   G    D+
Sbjct: 1   MREIISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDT 40


>At5g19770.1 68418.m02350 tubulin alpha-3/alpha-5 chain (TUA3)
           nearly identical to SP|P20363 Tubulin alpha-3/alpha-5
           chain {Arabidopsis thaliana}
          Length = 450

 Score = 96.7 bits (230), Expect = 1e-20
 Identities = 41/80 (51%), Positives = 56/80 (70%)
 Frame = +2

Query: 263 NVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYT 442
           N +++E   GK+VPRAV VDLEP  +D VR+G + Q+F P+  + G+  A NN+A+GHYT
Sbjct: 50  NTFFSETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYT 109

Query: 443 EGAELVDSVLDVVRKEAEGC 502
            G E+VD  LD VRK A+ C
Sbjct: 110 VGKEIVDLCLDRVRKLADNC 129



 Score = 40.3 bits (90), Expect = 0.001
 Identities = 18/40 (45%), Positives = 22/40 (55%)
 Frame = +3

Query: 123 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDS 242
           MREI+ I  GQ G Q+G   WE+   EHGI   G    D+
Sbjct: 1   MREIISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDT 40


>At4g14960.2 68417.m02299 tubulin alpha-6 chain (TUA6) nearly
           identical to SP|P29511 Tubulin alpha-6 chain
           {Arabidopsis thaliana}
          Length = 450

 Score = 95.9 bits (228), Expect = 2e-20
 Identities = 40/80 (50%), Positives = 56/80 (70%)
 Frame = +2

Query: 263 NVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYT 442
           N +++E   GK+VPRAV VDLEP  +D VR+G + Q+F P+  + G+  A NN+A+GHYT
Sbjct: 50  NTFFSETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYT 109

Query: 443 EGAELVDSVLDVVRKEAEGC 502
            G E+VD  LD +RK A+ C
Sbjct: 110 IGKEIVDLCLDRIRKLADNC 129



 Score = 39.9 bits (89), Expect = 0.001
 Identities = 18/39 (46%), Positives = 21/39 (53%)
 Frame = +3

Query: 123 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGD 239
           MRE + I  GQ G Q+G   WE+   EHGI   G   GD
Sbjct: 1   MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGD 39


>At4g14960.1 68417.m02298 tubulin alpha-6 chain (TUA6) nearly
           identical to SP|P29511 Tubulin alpha-6 chain
           {Arabidopsis thaliana}
          Length = 427

 Score = 95.9 bits (228), Expect = 2e-20
 Identities = 40/80 (50%), Positives = 56/80 (70%)
 Frame = +2

Query: 263 NVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYT 442
           N +++E   GK+VPRAV VDLEP  +D VR+G + Q+F P+  + G+  A NN+A+GHYT
Sbjct: 50  NTFFSETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYT 109

Query: 443 EGAELVDSVLDVVRKEAEGC 502
            G E+VD  LD +RK A+ C
Sbjct: 110 IGKEIVDLCLDRIRKLADNC 129



 Score = 39.9 bits (89), Expect = 0.001
 Identities = 18/39 (46%), Positives = 21/39 (53%)
 Frame = +3

Query: 123 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGD 239
           MRE + I  GQ G Q+G   WE+   EHGI   G   GD
Sbjct: 1   MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGD 39


>At1g50010.1 68414.m05612 tubulin alpha-2/alpha-4 chain (TUA2)
           identical to tubulin alpha-2/alpha-4 chain SP|P29510
           GB:P29510 from [Arabidopsis thaliana]
          Length = 450

 Score = 95.9 bits (228), Expect = 2e-20
 Identities = 40/80 (50%), Positives = 56/80 (70%)
 Frame = +2

Query: 263 NVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYT 442
           N +++E   GK+VPRAV VDLEP  +D VR+G + Q+F P+  + G+  A NN+A+GHYT
Sbjct: 50  NTFFSETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYT 109

Query: 443 EGAELVDSVLDVVRKEAEGC 502
            G E+VD  LD +RK A+ C
Sbjct: 110 IGKEIVDLCLDRIRKLADNC 129



 Score = 37.5 bits (83), Expect = 0.008
 Identities = 17/39 (43%), Positives = 20/39 (51%)
 Frame = +3

Query: 123 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGD 239
           MRE + I  GQ G Q+G   WE+   EHGI   G    D
Sbjct: 1   MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSD 39


>At1g04820.1 68414.m00478 tubulin alpha-2/alpha-4 chain (TUA4)
           nearly identical to SP:P29510 Tubulin alpha-2/alpha-4
           chain from [Arabidopsis thaliana]
          Length = 450

 Score = 95.9 bits (228), Expect = 2e-20
 Identities = 40/80 (50%), Positives = 56/80 (70%)
 Frame = +2

Query: 263 NVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYT 442
           N +++E   GK+VPRAV VDLEP  +D VR+G + Q+F P+  + G+  A NN+A+GHYT
Sbjct: 50  NTFFSETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYT 109

Query: 443 EGAELVDSVLDVVRKEAEGC 502
            G E+VD  LD +RK A+ C
Sbjct: 110 IGKEIVDLCLDRIRKLADNC 129



 Score = 37.5 bits (83), Expect = 0.008
 Identities = 17/39 (43%), Positives = 20/39 (51%)
 Frame = +3

Query: 123 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGD 239
           MRE + I  GQ G Q+G   WE+   EHGI   G    D
Sbjct: 1   MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSD 39


>At1g64740.1 68414.m07340 tubulin alpha-1 chain (TUA1) nearly
           identical to SP|P11139 Tubulin alpha-1 chain
           {Arabidopsis thaliana}
          Length = 450

 Score = 93.9 bits (223), Expect = 8e-20
 Identities = 38/80 (47%), Positives = 58/80 (72%)
 Frame = +2

Query: 263 NVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYT 442
           N +++E S G++VPRAV +DLEP  +D VR+G + Q+F P+  + G+  A NN+A+GHYT
Sbjct: 50  NTFFSETSSGQHVPRAVFLDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYT 109

Query: 443 EGAELVDSVLDVVRKEAEGC 502
            G E+VD+ L+ +RK A+ C
Sbjct: 110 VGREIVDTCLERLRKLADNC 129



 Score = 41.9 bits (94), Expect = 4e-04
 Identities = 19/40 (47%), Positives = 22/40 (55%)
 Frame = +3

Query: 123 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDS 242
           MREI+ I  GQ G Q+G   WE+   EHGI   G    DS
Sbjct: 1   MREIISIHIGQAGIQVGNSCWELYCLEHGIQPDGTMPSDS 40


>At5g05620.1 68418.m00612 tubulin gamma-2 chain / gamma-2 tubulin
           (TUBG2) identical to  SP|P38558 Tubulin gamma-2 chain
           (Gamma-2 tubulin) {Arabidopsis thaliana}
          Length = 474

 Score = 69.3 bits (162), Expect = 2e-12
 Identities = 29/90 (32%), Positives = 55/90 (61%), Gaps = 2/90 (2%)
 Frame = +2

Query: 257 RINVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQ--SGAGNNWAK 430
           R +V++ +A    Y+PRA+++DLEP  ++ +++G +  ++  +N        GAGNNWA 
Sbjct: 47  RKDVFFYQADDQHYIPRALLIDLEPRVINGIQNGEYRNLYNHENIFLSDHGGGAGNNWAS 106

Query: 431 GHYTEGAELVDSVLDVVRKEAEGCDCCRVF 520
           G Y +G  + + ++D++ +EA+G D    F
Sbjct: 107 G-YHQGKGVEEEIMDMIDREADGSDSLEGF 135



 Score = 48.0 bits (109), Expect = 5e-06
 Identities = 19/33 (57%), Positives = 24/33 (72%)
 Frame = +3

Query: 126 REIVHIQAGQCGNQIGAKFWEVISDEHGIDATG 224
           REI+ +Q GQCGNQIG +FW+ +  EHGI   G
Sbjct: 3   REIITLQVGQCGNQIGMEFWKQLCLEHGISKDG 35


>At3g61650.1 68416.m06909 tubulin gamma-1 chain / gamma-1 tubulin
           (TUBG1) identical to SP|P38557 Tubulin gamma-1 chain
           (Gamma-1 tubulin) {Arabidopsis thaliana}
          Length = 474

 Score = 68.9 bits (161), Expect = 3e-12
 Identities = 29/90 (32%), Positives = 55/90 (61%), Gaps = 2/90 (2%)
 Frame = +2

Query: 257 RINVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQ--SGAGNNWAK 430
           R +V++ +A    Y+PRA+++DLEP  ++ +++G +  ++  +N        GAGNNWA 
Sbjct: 47  RKDVFFYQADDQHYIPRALLIDLEPRVINGIQNGDYRNLYNHENIFVADHGGGAGNNWAS 106

Query: 431 GHYTEGAELVDSVLDVVRKEAEGCDCCRVF 520
           G Y +G  + + ++D++ +EA+G D    F
Sbjct: 107 G-YHQGKGVEEEIMDMIDREADGSDSLEGF 135



 Score = 48.0 bits (109), Expect = 5e-06
 Identities = 19/33 (57%), Positives = 24/33 (72%)
 Frame = +3

Query: 126 REIVHIQAGQCGNQIGAKFWEVISDEHGIDATG 224
           REI+ +Q GQCGNQIG +FW+ +  EHGI   G
Sbjct: 3   REIITLQVGQCGNQIGMEFWKQLCLEHGISKDG 35


>At4g37190.1 68417.m05265 expressed protein
          Length = 562

 Score = 30.3 bits (65), Expect = 1.2
 Identities = 12/21 (57%), Positives = 15/21 (71%)
 Frame = +3

Query: 123 MREIVHIQAGQCGNQIGAKFW 185
           MREIV IQ G+  N +G+ FW
Sbjct: 1   MREIVTIQVGEFANFVGSHFW 21


>At3g10900.1 68416.m01312 (1-4)-beta-mannan endohydrolase, putative
           similar to (1-4)-beta-mannan endohydrolase [Coffea
           arabica] GI:10178872, (1-4)-beta-mannan endohydrolase
           GB:AAB87859 [Lycopersicon esculentum]; contains Pfam
           profile PF00150: Cellulase (glycosyl hydrolase family 5)
          Length = 408

 Score = 29.5 bits (63), Expect = 2.0
 Identities = 16/49 (32%), Positives = 27/49 (55%)
 Frame = +3

Query: 129 EIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDLQLNASMSTI 275
           +I++  A + G+  GA FWEVIS     +    ++G S + L+   ST+
Sbjct: 346 DIIYASAQKGGSAAGALFWEVIS-----EGMSNFAGPSSIILSDKSSTV 389


>At2g31580.1 68415.m03858 expressed protein   contains Pfam profile:
           PF04446 family of unknown function (DUF549)
          Length = 567

 Score = 29.5 bits (63), Expect = 2.0
 Identities = 13/22 (59%), Positives = 18/22 (81%)
 Frame = +2

Query: 455 LVDSVLDVVRKEAEGCDCCRVF 520
           +++SV  VVRKEAE C+C +VF
Sbjct: 1   MINSV-GVVRKEAENCNCLQVF 21


>At2g26850.1 68415.m03221 F-box family protein contains Pfam
           PF00646: F-box domain; similar to SKP1 interacting
           partner 2 (SKIP2) TIGR_Ath1:At5g67250
          Length = 371

 Score = 29.5 bits (63), Expect = 2.0
 Identities = 12/30 (40%), Positives = 18/30 (60%)
 Frame = -2

Query: 185 PELCSDLIPALTRLDVDDFPHDCTKNLEPP 96
           P+L S ++  ++ LD+ D P DC   L PP
Sbjct: 50  PDLASPVLGKMSILDLPDLPLDCILELLPP 79


>At3g24550.1 68416.m03083 protein kinase family protein contains
           Pfam domain PF00069: Protein kinase domain
          Length = 652

 Score = 29.1 bits (62), Expect = 2.7
 Identities = 22/64 (34%), Positives = 28/64 (43%), Gaps = 4/64 (6%)
 Frame = -2

Query: 473 PVPNQPVQPPLCNVLSP-SYSPPQTVRRRSCPVGRFAQ---TARNGRSPWFQAQGPPSQL 306
           P P+ P+ P L     P S +PP      S P+        T  N RSP    QGPP+  
Sbjct: 54  PPPSSPLPPSLPPPSPPGSLTPPLPQPSPSAPITPSPPSPTTPSNPRSPPSPNQGPPNTP 113

Query: 305 AGRT 294
           +G T
Sbjct: 114 SGST 117


>At1g69500.1 68414.m07986 cytochrome P450 family protein similar to
           Cytochrome P450 86A2 (SP:O23066) [Arabidopsis
           thaliana]contains Pfam profile: PF00067: Cytochrome P450
          Length = 478

 Score = 27.5 bits (58), Expect = 8.1
 Identities = 13/30 (43%), Positives = 18/30 (60%)
 Frame = -2

Query: 476 HPVPNQPVQPPLCNVLSPSYSPPQTVRRRS 387
           H VPN PV+  +  +LS ++    TV RRS
Sbjct: 449 HLVPNHPVKYRMMTILSMAHGLKVTVSRRS 478


>At1g54970.1 68414.m06278 proline-rich family protein similar to
           proline-rich protein GI:170048 from [Glycine max]
          Length = 335

 Score = 27.5 bits (58), Expect = 8.1
 Identities = 12/22 (54%), Positives = 13/22 (59%)
 Frame = -2

Query: 473 PVPNQPVQPPLCNVLSPSYSPP 408
           PV  +P  PP     SPSYSPP
Sbjct: 169 PVYTKPTLPPPVYKKSPSYSPP 190


>At1g53300.1 68414.m06041 thioredoxin family protein contains Pfam
           profiles PF00085: Thioredoxin, PF00515: TPR Domain;
           similar to tetratricopeptide repeat protein 2
           (GI:7248701) [Drosophila melanogaster]; similar to DnaJ
           homolog subfamily C member 7 (Tetratricopeptide repeat
           protein 2) (TPR repeat protein 2) (Swiss-Prot:Q99615)
           [Homo sapiens]
          Length = 699

 Score = 27.5 bits (58), Expect = 8.1
 Identities = 15/40 (37%), Positives = 18/40 (45%), Gaps = 1/40 (2%)
 Frame = -1

Query: 414 PAPDCPKTKLSGRKICPNGPERTESMVPG-SRSTITARGT 298
           PAP  P   L    ICP+G  +   M    SRS +   GT
Sbjct: 129 PAPTSPANVLPTGNICPSGKIQITGMTQSRSRSDVLGSGT 168


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 15,073,043
Number of Sequences: 28952
Number of extensions: 331878
Number of successful extensions: 1147
Number of sequences better than 10.0: 26
Number of HSP's better than 10.0 without gapping: 978
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1134
length of database: 12,070,560
effective HSP length: 78
effective length of database: 9,812,304
effective search space used: 1344285648
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).