SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= tesS0034
         (598 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At5g42840.1 68418.m05221 DC1 domain-containing protein contains ...    27   7.2  
At3g50570.1 68416.m05531 hydroxyproline-rich glycoprotein family...    27   9.5  
At1g73100.1 68414.m08452 SET domain-containing protein (SUVH3) i...    27   9.5  

>At5g42840.1 68418.m05221 DC1 domain-containing protein contains
           Pfam profile PF03107: DC1 domain
          Length = 671

 Score = 27.5 bits (58), Expect = 7.2
 Identities = 20/69 (28%), Positives = 30/69 (43%), Gaps = 5/69 (7%)
 Frame = +2

Query: 2   TTVTYPTSSDSPYIFSGEACLDLDKKKQGHKTSVRYLINISNNRNQEAIAA--EI---GF 166
           T   Y  S  S      E C ++ KKK+   + V  ++ + N RN E   A  ++   GF
Sbjct: 398 TDTFYNCSESSCSFVLHETCANISKKKRHFLSPVPLVLCLQNQRNTETCNACQQVFCKGF 457

Query: 167 FHPRFDKEV 193
            +  F K V
Sbjct: 458 IYSSFPKTV 466


>At3g50570.1 68416.m05531 hydroxyproline-rich glycoprotein family
           protein contains proline-rich protein domains,
           INTERPRO:IPR000694
          Length = 189

 Score = 27.1 bits (57), Expect = 9.5
 Identities = 10/34 (29%), Positives = 19/34 (55%)
 Frame = -3

Query: 407 VFALLCTSTVPSKSITFTNGVWAKKTNLVGETSN 306
           + ALLC  ++P+ ++  T   W K ++L    +N
Sbjct: 7   IVALLCLVSLPNPTVGSTKKPWPKPSDLANHNNN 40


>At1g73100.1 68414.m08452 SET domain-containing protein (SUVH3)
           identical to SUVH3 [Arabidopsis thaliana] GI:13517747;
           contains Pfam profiles PF00856: SET domain, PF05033:
           Pre-SET motif, PF02182: YDG/SRA domain; identical to
           cDNA SUVH3 (SUVH3) GI:14625477
          Length = 669

 Score = 27.1 bits (57), Expect = 9.5
 Identities = 9/23 (39%), Positives = 15/23 (65%)
 Frame = -1

Query: 193 YLLIKSWVEESDFGCNSFLIPII 125
           Y + +SWVE+   GCN+F   ++
Sbjct: 332 YSISESWVEKGKSGCNTFKYKLV 354


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 13,278,840
Number of Sequences: 28952
Number of extensions: 274741
Number of successful extensions: 748
Number of sequences better than 10.0: 3
Number of HSP's better than 10.0 without gapping: 733
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 748
length of database: 12,070,560
effective HSP length: 77
effective length of database: 9,841,256
effective search space used: 1190791976
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).