SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= tesS0033
         (698 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At5g23860.1 68418.m02801 tubulin beta-8 chain (TUB8) (TUBB8) ide...   157   9e-39
At5g62700.1 68418.m07868 tubulin beta-2/beta-3 chain (TUB3) near...   156   2e-38
At5g62690.1 68418.m07867 tubulin beta-2/beta-3 chain (TUB2) near...   156   2e-38
At2g29550.1 68415.m03589 tubulin beta-7 chain (TUB7) identical t...   156   2e-38
At1g20010.1 68414.m02506 tubulin beta-5 chain (TUB5) nearly iden...   156   2e-38
At5g12250.1 68418.m01439 tubulin beta-6 chain (TUB6) nearly iden...   155   2e-38
At1g75780.1 68414.m08801 tubulin beta-1 chain (TUB1) nearly iden...   155   3e-38
At5g44340.1 68418.m05429 tubulin beta-4 chain (TUB4) nearly iden...   154   6e-38
At4g20890.1 68417.m03029 tubulin beta-9 chain (TUB9) nearly iden...   153   8e-38
At1g64740.1 68414.m07340 tubulin alpha-1 chain (TUA1) nearly ide...    95   4e-20
At5g19780.1 68418.m02351 tubulin alpha-3/alpha-5 chain (TUA5) ne...    95   5e-20
At5g19770.1 68418.m02350 tubulin alpha-3/alpha-5 chain (TUA3) ne...    95   5e-20
At4g14960.2 68417.m02299 tubulin alpha-6 chain (TUA6) nearly ide...    88   6e-18
At4g14960.1 68417.m02298 tubulin alpha-6 chain (TUA6) nearly ide...    88   6e-18
At1g50010.1 68414.m05612 tubulin alpha-2/alpha-4 chain (TUA2) id...    88   6e-18
At1g04820.1 68414.m00478 tubulin alpha-2/alpha-4 chain (TUA4) ne...    88   6e-18
At5g05620.1 68418.m00612 tubulin gamma-2 chain / gamma-2 tubulin...    63   2e-10
At3g61650.1 68416.m06909 tubulin gamma-1 chain / gamma-1 tubulin...    63   2e-10
At3g21720.1 68416.m02740 isocitrate lyase, putative similar to i...    31   0.73 
At3g21420.1 68416.m02703 oxidoreductase, 2OG-Fe(II) oxygenase fa...    30   1.3  
At1g44900.1 68414.m05144 DNA replication licensing factor, putat...    27   9.0  

>At5g23860.1 68418.m02801 tubulin beta-8 chain (TUB8) (TUBB8)
           identical to SP|P29516 Tubulin beta-8 chain {Arabidopsis
           thaliana}; supporting cDNA gi|15451225|gb|AY054693.1|
          Length = 449

 Score =  157 bits (380), Expect = 9e-39
 Identities = 69/87 (79%), Positives = 79/87 (90%)
 Frame = +2

Query: 2   SGITTCLRFPGQLNADLRKLAVNMVPFPRLHFYTPGFAPLTSRGAQQYRALTVPELTLQM 181
           SG+T CLRFPGQLN+DLRKLAVN++PFPRLHF+  GFAPLTSRG+QQYRALTVPELT QM
Sbjct: 234 SGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTVPELTQQM 293

Query: 182 FDAKNMMVACDPRHGRYLTVATIFRGE 262
           +DAKNMM A DPRHGRYLT + +FRG+
Sbjct: 294 WDAKNMMCAADPRHGRYLTASAMFRGK 320



 Score =  156 bits (378), Expect = 2e-38
 Identities = 68/85 (80%), Positives = 77/85 (90%)
 Frame = +1

Query: 253 QGRMSMKEVDEQLANIQNKNSTYFVEWIPNNCKIAVCDIPPRGLKMASTFIGNTTAIQTI 432
           +G+MS KEVDEQ+ N+QNKNS+YFVEWIPNN K  VCDIPP GLKMASTFIGN+T+IQ +
Sbjct: 318 RGKMSTKEVDEQMINVQNKNSSYFVEWIPNNVKSTVCDIPPTGLKMASTFIGNSTSIQEM 377

Query: 433 FKRVSEQFVAMFRRKAFLHWYTGEG 507
           F+RVSEQF AMFRRKAFLHWYTGEG
Sbjct: 378 FRRVSEQFTAMFRRKAFLHWYTGEG 402



 Score = 54.4 bits (125), Expect = 7e-08
 Identities = 26/34 (76%), Positives = 28/34 (82%), Gaps = 3/34 (8%)
 Frame = +3

Query: 486 ALVHW*---G*DEMEFTEAESNMNDLISEYQQYQ 578
           A +HW    G DEMEFTEAESNMNDL+SEYQQYQ
Sbjct: 393 AFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQ 426


>At5g62700.1 68418.m07868 tubulin beta-2/beta-3 chain (TUB3) nearly
           identical to SP|P29512 Tubulin beta-2/beta-3 chain
           {Arabidopsis thaliana}
          Length = 450

 Score =  156 bits (378), Expect = 2e-38
 Identities = 68/85 (80%), Positives = 77/85 (90%)
 Frame = +1

Query: 253 QGRMSMKEVDEQLANIQNKNSTYFVEWIPNNCKIAVCDIPPRGLKMASTFIGNTTAIQTI 432
           +G+MS KEVDEQ+ N+QNKNS+YFVEWIPNN K  VCDIPP GLKMASTFIGN+T+IQ +
Sbjct: 318 RGKMSTKEVDEQMLNVQNKNSSYFVEWIPNNVKSTVCDIPPTGLKMASTFIGNSTSIQEM 377

Query: 433 FKRVSEQFVAMFRRKAFLHWYTGEG 507
           F+RVSEQF AMFRRKAFLHWYTGEG
Sbjct: 378 FRRVSEQFTAMFRRKAFLHWYTGEG 402



 Score =  154 bits (374), Expect = 5e-38
 Identities = 67/87 (77%), Positives = 79/87 (90%)
 Frame = +2

Query: 2   SGITTCLRFPGQLNADLRKLAVNMVPFPRLHFYTPGFAPLTSRGAQQYRALTVPELTLQM 181
           SG+T CLRFPGQLN+DLRKLAVN++PFPRLHF+  GFAPLTSRG+QQYR+LTVPELT QM
Sbjct: 234 SGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRSLTVPELTQQM 293

Query: 182 FDAKNMMVACDPRHGRYLTVATIFRGE 262
           +D+KNMM A DPRHGRYLT + +FRG+
Sbjct: 294 WDSKNMMCAADPRHGRYLTASAMFRGK 320



 Score = 54.4 bits (125), Expect = 7e-08
 Identities = 26/34 (76%), Positives = 28/34 (82%), Gaps = 3/34 (8%)
 Frame = +3

Query: 486 ALVHW*---G*DEMEFTEAESNMNDLISEYQQYQ 578
           A +HW    G DEMEFTEAESNMNDL+SEYQQYQ
Sbjct: 393 AFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQ 426


>At5g62690.1 68418.m07867 tubulin beta-2/beta-3 chain (TUB2) nearly
           identical to SP|P29512 Tubulin beta-2/beta-3 chain
           {Arabidopsis thaliana}
          Length = 450

 Score =  156 bits (378), Expect = 2e-38
 Identities = 68/85 (80%), Positives = 77/85 (90%)
 Frame = +1

Query: 253 QGRMSMKEVDEQLANIQNKNSTYFVEWIPNNCKIAVCDIPPRGLKMASTFIGNTTAIQTI 432
           +G+MS KEVDEQ+ N+QNKNS+YFVEWIPNN K  VCDIPP GLKMASTFIGN+T+IQ +
Sbjct: 318 RGKMSTKEVDEQMLNVQNKNSSYFVEWIPNNVKSTVCDIPPTGLKMASTFIGNSTSIQEM 377

Query: 433 FKRVSEQFVAMFRRKAFLHWYTGEG 507
           F+RVSEQF AMFRRKAFLHWYTGEG
Sbjct: 378 FRRVSEQFTAMFRRKAFLHWYTGEG 402



 Score =  154 bits (374), Expect = 5e-38
 Identities = 67/87 (77%), Positives = 79/87 (90%)
 Frame = +2

Query: 2   SGITTCLRFPGQLNADLRKLAVNMVPFPRLHFYTPGFAPLTSRGAQQYRALTVPELTLQM 181
           SG+T CLRFPGQLN+DLRKLAVN++PFPRLHF+  GFAPLTSRG+QQYR+LTVPELT QM
Sbjct: 234 SGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRSLTVPELTQQM 293

Query: 182 FDAKNMMVACDPRHGRYLTVATIFRGE 262
           +D+KNMM A DPRHGRYLT + +FRG+
Sbjct: 294 WDSKNMMCAADPRHGRYLTASAMFRGK 320



 Score = 54.4 bits (125), Expect = 7e-08
 Identities = 26/34 (76%), Positives = 28/34 (82%), Gaps = 3/34 (8%)
 Frame = +3

Query: 486 ALVHW*---G*DEMEFTEAESNMNDLISEYQQYQ 578
           A +HW    G DEMEFTEAESNMNDL+SEYQQYQ
Sbjct: 393 AFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQ 426


>At2g29550.1 68415.m03589 tubulin beta-7 chain (TUB7) identical to
           GB:M84704 SP|P29515 Tubulin beta-7 chain {Arabidopsis
           thaliana}
          Length = 449

 Score =  156 bits (378), Expect = 2e-38
 Identities = 68/85 (80%), Positives = 77/85 (90%)
 Frame = +1

Query: 253 QGRMSMKEVDEQLANIQNKNSTYFVEWIPNNCKIAVCDIPPRGLKMASTFIGNTTAIQTI 432
           +G+MS KEVDEQ+ N+QNKNS+YFVEWIPNN K  VCDIPP GLKMASTFIGN+T+IQ +
Sbjct: 318 RGKMSTKEVDEQMLNVQNKNSSYFVEWIPNNVKSTVCDIPPTGLKMASTFIGNSTSIQEM 377

Query: 433 FKRVSEQFVAMFRRKAFLHWYTGEG 507
           F+RVSEQF AMFRRKAFLHWYTGEG
Sbjct: 378 FRRVSEQFTAMFRRKAFLHWYTGEG 402



 Score =  154 bits (374), Expect = 5e-38
 Identities = 68/87 (78%), Positives = 78/87 (89%)
 Frame = +2

Query: 2   SGITTCLRFPGQLNADLRKLAVNMVPFPRLHFYTPGFAPLTSRGAQQYRALTVPELTLQM 181
           SG+T CLRFPGQLN+DLRKLAVN++PFPRLHF+  GFAPLTSRG+QQYR LTVPELT QM
Sbjct: 234 SGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRNLTVPELTQQM 293

Query: 182 FDAKNMMVACDPRHGRYLTVATIFRGE 262
           +DAKNMM A DPRHGRYLT + +FRG+
Sbjct: 294 WDAKNMMCAADPRHGRYLTASAMFRGK 320



 Score = 54.4 bits (125), Expect = 7e-08
 Identities = 26/34 (76%), Positives = 28/34 (82%), Gaps = 3/34 (8%)
 Frame = +3

Query: 486 ALVHW*---G*DEMEFTEAESNMNDLISEYQQYQ 578
           A +HW    G DEMEFTEAESNMNDL+SEYQQYQ
Sbjct: 393 AFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQ 426


>At1g20010.1 68414.m02506 tubulin beta-5 chain (TUB5) nearly
           identical to SP|P29513 Tubulin beta-5 chain {Arabidopsis
           thaliana}
          Length = 449

 Score =  156 bits (378), Expect = 2e-38
 Identities = 67/85 (78%), Positives = 79/85 (92%)
 Frame = +1

Query: 253 QGRMSMKEVDEQLANIQNKNSTYFVEWIPNNCKIAVCDIPPRGLKMASTFIGNTTAIQTI 432
           +G+MS KEVDEQ+ NIQNKNS+YFVEWIPNN K +VCDIPP+GLKMA+TF+GN+T+IQ +
Sbjct: 319 RGQMSTKEVDEQILNIQNKNSSYFVEWIPNNVKSSVCDIPPKGLKMAATFVGNSTSIQEM 378

Query: 433 FKRVSEQFVAMFRRKAFLHWYTGEG 507
           F+RVSEQF AMFRRKAFLHWYTGEG
Sbjct: 379 FRRVSEQFTAMFRRKAFLHWYTGEG 403



 Score =  149 bits (360), Expect = 2e-36
 Identities = 66/87 (75%), Positives = 77/87 (88%)
 Frame = +2

Query: 2   SGITTCLRFPGQLNADLRKLAVNMVPFPRLHFYTPGFAPLTSRGAQQYRALTVPELTLQM 181
           SG+T  LRFPGQLN+DLRKLAVN++PFPRLHF+  GFAPLTSRG+QQY +LTVPELT QM
Sbjct: 235 SGVTCSLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYISLTVPELTQQM 294

Query: 182 FDAKNMMVACDPRHGRYLTVATIFRGE 262
           +D+KNMM A DPRHGRYLT + IFRG+
Sbjct: 295 WDSKNMMCAADPRHGRYLTASAIFRGQ 321



 Score = 53.2 bits (122), Expect = 2e-07
 Identities = 25/34 (73%), Positives = 28/34 (82%), Gaps = 3/34 (8%)
 Frame = +3

Query: 486 ALVHW*---G*DEMEFTEAESNMNDLISEYQQYQ 578
           A +HW    G DEMEFTEAESNMNDL++EYQQYQ
Sbjct: 394 AFLHWYTGEGMDEMEFTEAESNMNDLVAEYQQYQ 427


>At5g12250.1 68418.m01439 tubulin beta-6 chain (TUB6) nearly
           identical to SP|P29514 Tubulin beta-6 chain {Arabidopsis
           thaliana}
          Length = 449

 Score =  155 bits (377), Expect = 2e-38
 Identities = 68/87 (78%), Positives = 79/87 (90%)
 Frame = +2

Query: 2   SGITTCLRFPGQLNADLRKLAVNMVPFPRLHFYTPGFAPLTSRGAQQYRALTVPELTLQM 181
           SG+T CLRFPGQLN+DLRKLAVN++PFPRLHF+  GFAPLTSRG+QQYRALTVPELT QM
Sbjct: 234 SGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTVPELTQQM 293

Query: 182 FDAKNMMVACDPRHGRYLTVATIFRGE 262
           +D+KNMM A DPRHGRYLT + +FRG+
Sbjct: 294 WDSKNMMCAADPRHGRYLTASAMFRGK 320



 Score =  153 bits (372), Expect = 8e-38
 Identities = 67/85 (78%), Positives = 77/85 (90%)
 Frame = +1

Query: 253 QGRMSMKEVDEQLANIQNKNSTYFVEWIPNNCKIAVCDIPPRGLKMASTFIGNTTAIQTI 432
           +G+MS KEVDEQ+ N+QNKNS+YFVEWIPNN K +VCDI PRGL MASTFIGN+T+IQ +
Sbjct: 318 RGKMSTKEVDEQMINVQNKNSSYFVEWIPNNVKSSVCDIAPRGLSMASTFIGNSTSIQEM 377

Query: 433 FKRVSEQFVAMFRRKAFLHWYTGEG 507
           F+RVSEQF AMFRRKAFLHWYTGEG
Sbjct: 378 FRRVSEQFTAMFRRKAFLHWYTGEG 402



 Score = 54.4 bits (125), Expect = 7e-08
 Identities = 26/34 (76%), Positives = 28/34 (82%), Gaps = 3/34 (8%)
 Frame = +3

Query: 486 ALVHW*---G*DEMEFTEAESNMNDLISEYQQYQ 578
           A +HW    G DEMEFTEAESNMNDL+SEYQQYQ
Sbjct: 393 AFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQ 426


>At1g75780.1 68414.m08801 tubulin beta-1 chain (TUB1) nearly
           identical to SP|P12411 Tubulin beta-1 chain {Arabidopsis
           thaliana}
          Length = 447

 Score =  155 bits (376), Expect = 3e-38
 Identities = 66/85 (77%), Positives = 78/85 (91%)
 Frame = +1

Query: 253 QGRMSMKEVDEQLANIQNKNSTYFVEWIPNNCKIAVCDIPPRGLKMASTFIGNTTAIQTI 432
           +G+MS KEVDEQ+ N+QNKNS+YFVEWIPNN K +VCDIPP G+KMASTF+GN+T+IQ +
Sbjct: 319 RGKMSTKEVDEQILNVQNKNSSYFVEWIPNNVKSSVCDIPPTGIKMASTFVGNSTSIQEM 378

Query: 433 FKRVSEQFVAMFRRKAFLHWYTGEG 507
           F+RVSEQF AMFRRKAFLHWYTGEG
Sbjct: 379 FRRVSEQFTAMFRRKAFLHWYTGEG 403



 Score =  148 bits (359), Expect = 3e-36
 Identities = 66/87 (75%), Positives = 77/87 (88%)
 Frame = +2

Query: 2   SGITTCLRFPGQLNADLRKLAVNMVPFPRLHFYTPGFAPLTSRGAQQYRALTVPELTLQM 181
           SG+T  LRFPGQLN+DLRKLAVN++PFPRLHF+  GFAPLTSRG+QQY +LTVPELT QM
Sbjct: 235 SGVTCSLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYISLTVPELTQQM 294

Query: 182 FDAKNMMVACDPRHGRYLTVATIFRGE 262
           +DAKNMM A DPRHGRYLT + +FRG+
Sbjct: 295 WDAKNMMCAADPRHGRYLTASAMFRGK 321



 Score = 54.4 bits (125), Expect = 7e-08
 Identities = 26/34 (76%), Positives = 28/34 (82%), Gaps = 3/34 (8%)
 Frame = +3

Query: 486 ALVHW*---G*DEMEFTEAESNMNDLISEYQQYQ 578
           A +HW    G DEMEFTEAESNMNDL+SEYQQYQ
Sbjct: 394 AFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQ 427


>At5g44340.1 68418.m05429 tubulin beta-4 chain (TUB4) nearly
           identical to SP|P24636 Tubulin beta-4 chain {Arabidopsis
           thaliana}
          Length = 444

 Score =  154 bits (373), Expect = 6e-38
 Identities = 69/105 (65%), Positives = 84/105 (80%)
 Frame = +2

Query: 2   SGITTCLRFPGQLNADLRKLAVNMVPFPRLHFYTPGFAPLTSRGAQQYRALTVPELTLQM 181
           SG+T CLRFPGQLN+DLRKLAVN++PFPRLHF+  GFAPLTSRG+QQY AL+VPELT QM
Sbjct: 234 SGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYSALSVPELTQQM 293

Query: 182 FDAKNMMVACDPRHGRYLTVATIFRGECL*KKLTSNWRIFRTKTA 316
           +DAKNMM A DPRHGRYLT + +FRG+   K++       + K +
Sbjct: 294 WDAKNMMCAADPRHGRYLTASAVFRGKLSTKEVDEQMMNIQNKNS 338



 Score =  153 bits (372), Expect = 8e-38
 Identities = 67/85 (78%), Positives = 78/85 (91%)
 Frame = +1

Query: 253 QGRMSMKEVDEQLANIQNKNSTYFVEWIPNNCKIAVCDIPPRGLKMASTFIGNTTAIQTI 432
           +G++S KEVDEQ+ NIQNKNS+YFVEWIPNN K +VCDI P+GLKMASTFIGN+T+IQ +
Sbjct: 318 RGKLSTKEVDEQMMNIQNKNSSYFVEWIPNNVKSSVCDIAPKGLKMASTFIGNSTSIQEM 377

Query: 433 FKRVSEQFVAMFRRKAFLHWYTGEG 507
           F+RVSEQF AMFRRKAFLHWYTGEG
Sbjct: 378 FRRVSEQFTAMFRRKAFLHWYTGEG 402



 Score = 53.2 bits (122), Expect = 2e-07
 Identities = 25/34 (73%), Positives = 28/34 (82%), Gaps = 3/34 (8%)
 Frame = +3

Query: 486 ALVHW*---G*DEMEFTEAESNMNDLISEYQQYQ 578
           A +HW    G DEMEFTEAESNMNDL++EYQQYQ
Sbjct: 393 AFLHWYTGEGMDEMEFTEAESNMNDLVAEYQQYQ 426


>At4g20890.1 68417.m03029 tubulin beta-9 chain (TUB9) nearly
           identical to SP|P29517 Tubulin beta-9 chain {Arabidopsis
           thaliana}
          Length = 444

 Score =  153 bits (372), Expect = 8e-38
 Identities = 67/87 (77%), Positives = 78/87 (89%)
 Frame = +2

Query: 2   SGITTCLRFPGQLNADLRKLAVNMVPFPRLHFYTPGFAPLTSRGAQQYRALTVPELTLQM 181
           SG+T CLRFPGQLN+DLRKLAVN++PFPRLHF+  GFAPLTSRG+QQY AL+VPELT QM
Sbjct: 234 SGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYSALSVPELTQQM 293

Query: 182 FDAKNMMVACDPRHGRYLTVATIFRGE 262
           +DAKNMM A DPRHGRYLT + +FRG+
Sbjct: 294 WDAKNMMCAADPRHGRYLTASAVFRGK 320



 Score =  153 bits (371), Expect = 1e-37
 Identities = 67/85 (78%), Positives = 77/85 (90%)
 Frame = +1

Query: 253 QGRMSMKEVDEQLANIQNKNSTYFVEWIPNNCKIAVCDIPPRGLKMASTFIGNTTAIQTI 432
           +G+MS KEVDEQ+ N+QNKNS+YFVEWIPNN K +VCDI P GLKMASTFIGN+T+IQ +
Sbjct: 318 RGKMSTKEVDEQMMNVQNKNSSYFVEWIPNNVKSSVCDIAPTGLKMASTFIGNSTSIQEM 377

Query: 433 FKRVSEQFVAMFRRKAFLHWYTGEG 507
           F+RVSEQF AMFRRKAFLHWYTGEG
Sbjct: 378 FRRVSEQFTAMFRRKAFLHWYTGEG 402



 Score = 53.2 bits (122), Expect = 2e-07
 Identities = 25/34 (73%), Positives = 28/34 (82%), Gaps = 3/34 (8%)
 Frame = +3

Query: 486 ALVHW*---G*DEMEFTEAESNMNDLISEYQQYQ 578
           A +HW    G DEMEFTEAESNMNDL++EYQQYQ
Sbjct: 393 AFLHWYTGEGMDEMEFTEAESNMNDLVAEYQQYQ 426


>At1g64740.1 68414.m07340 tubulin alpha-1 chain (TUA1) nearly
           identical to SP|P11139 Tubulin alpha-1 chain
           {Arabidopsis thaliana}
          Length = 450

 Score = 95.1 bits (226), Expect = 4e-20
 Identities = 37/95 (38%), Positives = 59/95 (62%)
 Frame = +2

Query: 2   SGITTCLRFPGQLNADLRKLAVNMVPFPRLHFYTPGFAPLTSRGAQQYRALTVPELTLQM 181
           S +TT LRF G +N D+ +   N+VP+PR+HF    +AP+ S     +   +VPE+T  +
Sbjct: 236 SSLTTSLRFDGAINVDITEFQTNLVPYPRIHFMLSSYAPVISSAKAYHEQFSVPEITTSV 295

Query: 182 FDAKNMMVACDPRHGRYLTVATIFRGECL*KKLTS 286
           F+  NMM  CDPRHG+Y+    ++RG+ + K + +
Sbjct: 296 FEPSNMMAKCDPRHGKYMACCLMYRGDVVPKDVNT 330



 Score = 60.9 bits (141), Expect = 8e-10
 Identities = 31/97 (31%), Positives = 50/97 (51%), Gaps = 8/97 (8%)
 Frame = +1

Query: 241 CDDIQGRMSMKEVDEQLANIQNKNSTYFVEWIPNNCKIAVCDIPPR--------GLKMAS 396
           C   +G +  K+V+  +A I+ K +  FV+W P   K  +   PP          ++ A 
Sbjct: 316 CLMYRGDVVPKDVNTAVAAIKAKRTIQFVDWCPTGFKCGINYQPPSVVPGGDLAKVQRAV 375

Query: 397 TFIGNTTAIQTIFKRVSEQFVAMFRRKAFLHWYTGEG 507
             I N TA+  +F R+  +F  M+ ++AF+HWY GEG
Sbjct: 376 CMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEG 412


>At5g19780.1 68418.m02351 tubulin alpha-3/alpha-5 chain (TUA5)
           nearly identical to SP|P20363 Tubulin alpha-3/alpha-5
           chain {Arabidopsis thaliana}
          Length = 450

 Score = 94.7 bits (225), Expect = 5e-20
 Identities = 39/103 (37%), Positives = 63/103 (61%)
 Frame = +2

Query: 2   SGITTCLRFPGQLNADLRKLAVNMVPFPRLHFYTPGFAPLTSRGAQQYRALTVPELTLQM 181
           S +TT LRF G +N D+ +   N+VP+PR+HF    +AP+ S     +  L+VPE+T  +
Sbjct: 236 SSLTTSLRFDGAINVDITEFQTNLVPYPRIHFMLSSYAPVISAAKAYHEQLSVPEITNAV 295

Query: 182 FDAKNMMVACDPRHGRYLTVATIFRGECL*KKLTSNWRIFRTK 310
           F+  +MM  CDPRHG+Y+    ++RG+ + K + +     +TK
Sbjct: 296 FEPASMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVGTIKTK 338



 Score = 61.3 bits (142), Expect = 6e-10
 Identities = 30/97 (30%), Positives = 49/97 (50%), Gaps = 8/97 (8%)
 Frame = +1

Query: 241 CDDIQGRMSMKEVDEQLANIQNKNSTYFVEWIPNNCKIAVCDIPPR--------GLKMAS 396
           C   +G +  K+V+  +  I+ K +  FV+W P   K  +   PP          ++ A 
Sbjct: 316 CLMYRGDVVPKDVNAAVGTIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAV 375

Query: 397 TFIGNTTAIQTIFKRVSEQFVAMFRRKAFLHWYTGEG 507
             I N TA+  +F R+  +F  M+ ++AF+HWY GEG
Sbjct: 376 CMISNNTAVAEVFSRIDHKFDLMYAKRAFVHWYVGEG 412


>At5g19770.1 68418.m02350 tubulin alpha-3/alpha-5 chain (TUA3)
           nearly identical to SP|P20363 Tubulin alpha-3/alpha-5
           chain {Arabidopsis thaliana}
          Length = 450

 Score = 94.7 bits (225), Expect = 5e-20
 Identities = 39/103 (37%), Positives = 63/103 (61%)
 Frame = +2

Query: 2   SGITTCLRFPGQLNADLRKLAVNMVPFPRLHFYTPGFAPLTSRGAQQYRALTVPELTLQM 181
           S +TT LRF G +N D+ +   N+VP+PR+HF    +AP+ S     +  L+VPE+T  +
Sbjct: 236 SSLTTSLRFDGAINVDITEFQTNLVPYPRIHFMLSSYAPVISAAKAYHEQLSVPEITNAV 295

Query: 182 FDAKNMMVACDPRHGRYLTVATIFRGECL*KKLTSNWRIFRTK 310
           F+  +MM  CDPRHG+Y+    ++RG+ + K + +     +TK
Sbjct: 296 FEPASMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVGTIKTK 338



 Score = 61.3 bits (142), Expect = 6e-10
 Identities = 30/97 (30%), Positives = 49/97 (50%), Gaps = 8/97 (8%)
 Frame = +1

Query: 241 CDDIQGRMSMKEVDEQLANIQNKNSTYFVEWIPNNCKIAVCDIPPR--------GLKMAS 396
           C   +G +  K+V+  +  I+ K +  FV+W P   K  +   PP          ++ A 
Sbjct: 316 CLMYRGDVVPKDVNAAVGTIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAV 375

Query: 397 TFIGNTTAIQTIFKRVSEQFVAMFRRKAFLHWYTGEG 507
             I N TA+  +F R+  +F  M+ ++AF+HWY GEG
Sbjct: 376 CMISNNTAVAEVFSRIDHKFDLMYAKRAFVHWYVGEG 412


>At4g14960.2 68417.m02299 tubulin alpha-6 chain (TUA6) nearly
           identical to SP|P29511 Tubulin alpha-6 chain
           {Arabidopsis thaliana}
          Length = 450

 Score = 87.8 bits (208), Expect = 6e-18
 Identities = 38/103 (36%), Positives = 60/103 (58%)
 Frame = +2

Query: 2   SGITTCLRFPGQLNADLRKLAVNMVPFPRLHFYTPGFAPLTSRGAQQYRALTVPELTLQM 181
           S +T  LRF G LN D+ +   N+VP+PR+HF    +AP+ S     +  L+V E+T   
Sbjct: 236 SSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAFHEQLSVAEITNSA 295

Query: 182 FDAKNMMVACDPRHGRYLTVATIFRGECL*KKLTSNWRIFRTK 310
           F+  +MM  CDPRHG+Y+    ++RG+ + K + +     +TK
Sbjct: 296 FEPASMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVGTIKTK 338



 Score = 60.1 bits (139), Expect = 1e-09
 Identities = 29/97 (29%), Positives = 50/97 (51%), Gaps = 8/97 (8%)
 Frame = +1

Query: 241 CDDIQGRMSMKEVDEQLANIQNKNSTYFVEWIPNNCKIAVCDIPPR--------GLKMAS 396
           C   +G +  K+V+  +  I+ K +  FV+W P   K  +   PP          ++ A 
Sbjct: 316 CLMYRGDVVPKDVNAAVGTIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAV 375

Query: 397 TFIGNTTAIQTIFKRVSEQFVAMFRRKAFLHWYTGEG 507
             I N+T++  +F R+  +F  M+ ++AF+HWY GEG
Sbjct: 376 CMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEG 412


>At4g14960.1 68417.m02298 tubulin alpha-6 chain (TUA6) nearly
           identical to SP|P29511 Tubulin alpha-6 chain
           {Arabidopsis thaliana}
          Length = 427

 Score = 87.8 bits (208), Expect = 6e-18
 Identities = 38/103 (36%), Positives = 60/103 (58%)
 Frame = +2

Query: 2   SGITTCLRFPGQLNADLRKLAVNMVPFPRLHFYTPGFAPLTSRGAQQYRALTVPELTLQM 181
           S +T  LRF G LN D+ +   N+VP+PR+HF    +AP+ S     +  L+V E+T   
Sbjct: 236 SSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAFHEQLSVAEITNSA 295

Query: 182 FDAKNMMVACDPRHGRYLTVATIFRGECL*KKLTSNWRIFRTK 310
           F+  +MM  CDPRHG+Y+    ++RG+ + K + +     +TK
Sbjct: 296 FEPASMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVGTIKTK 338



 Score = 29.1 bits (62), Expect = 3.0
 Identities = 13/45 (28%), Positives = 22/45 (48%)
 Frame = +1

Query: 241 CDDIQGRMSMKEVDEQLANIQNKNSTYFVEWIPNNCKIAVCDIPP 375
           C   +G +  K+V+  +  I+ K +  FV+W P   K  +   PP
Sbjct: 316 CLMYRGDVVPKDVNAAVGTIKTKRTIQFVDWCPTGFKCGINYQPP 360


>At1g50010.1 68414.m05612 tubulin alpha-2/alpha-4 chain (TUA2)
           identical to tubulin alpha-2/alpha-4 chain SP|P29510
           GB:P29510 from [Arabidopsis thaliana]
          Length = 450

 Score = 87.8 bits (208), Expect = 6e-18
 Identities = 38/103 (36%), Positives = 60/103 (58%)
 Frame = +2

Query: 2   SGITTCLRFPGQLNADLRKLAVNMVPFPRLHFYTPGFAPLTSRGAQQYRALTVPELTLQM 181
           S +T  LRF G LN D+ +   N+VP+PR+HF    +AP+ S     +  L+V E+T   
Sbjct: 236 SSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAFHEQLSVAEITNSA 295

Query: 182 FDAKNMMVACDPRHGRYLTVATIFRGECL*KKLTSNWRIFRTK 310
           F+  +MM  CDPRHG+Y+    ++RG+ + K + +     +TK
Sbjct: 296 FEPASMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVGTIKTK 338



 Score = 60.1 bits (139), Expect = 1e-09
 Identities = 29/97 (29%), Positives = 50/97 (51%), Gaps = 8/97 (8%)
 Frame = +1

Query: 241 CDDIQGRMSMKEVDEQLANIQNKNSTYFVEWIPNNCKIAVCDIPPR--------GLKMAS 396
           C   +G +  K+V+  +  I+ K +  FV+W P   K  +   PP          ++ A 
Sbjct: 316 CLMYRGDVVPKDVNAAVGTIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAV 375

Query: 397 TFIGNTTAIQTIFKRVSEQFVAMFRRKAFLHWYTGEG 507
             I N+T++  +F R+  +F  M+ ++AF+HWY GEG
Sbjct: 376 CMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEG 412


>At1g04820.1 68414.m00478 tubulin alpha-2/alpha-4 chain (TUA4)
           nearly identical to SP:P29510 Tubulin alpha-2/alpha-4
           chain from [Arabidopsis thaliana]
          Length = 450

 Score = 87.8 bits (208), Expect = 6e-18
 Identities = 38/103 (36%), Positives = 60/103 (58%)
 Frame = +2

Query: 2   SGITTCLRFPGQLNADLRKLAVNMVPFPRLHFYTPGFAPLTSRGAQQYRALTVPELTLQM 181
           S +T  LRF G LN D+ +   N+VP+PR+HF    +AP+ S     +  L+V E+T   
Sbjct: 236 SSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAFHEQLSVAEITNSA 295

Query: 182 FDAKNMMVACDPRHGRYLTVATIFRGECL*KKLTSNWRIFRTK 310
           F+  +MM  CDPRHG+Y+    ++RG+ + K + +     +TK
Sbjct: 296 FEPASMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVGTIKTK 338



 Score = 60.1 bits (139), Expect = 1e-09
 Identities = 29/97 (29%), Positives = 50/97 (51%), Gaps = 8/97 (8%)
 Frame = +1

Query: 241 CDDIQGRMSMKEVDEQLANIQNKNSTYFVEWIPNNCKIAVCDIPPR--------GLKMAS 396
           C   +G +  K+V+  +  I+ K +  FV+W P   K  +   PP          ++ A 
Sbjct: 316 CLMYRGDVVPKDVNAAVGTIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAV 375

Query: 397 TFIGNTTAIQTIFKRVSEQFVAMFRRKAFLHWYTGEG 507
             I N+T++  +F R+  +F  M+ ++AF+HWY GEG
Sbjct: 376 CMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEG 412


>At5g05620.1 68418.m00612 tubulin gamma-2 chain / gamma-2 tubulin
           (TUBG2) identical to  SP|P38558 Tubulin gamma-2 chain
           (Gamma-2 tubulin) {Arabidopsis thaliana}
          Length = 474

 Score = 62.9 bits (146), Expect = 2e-10
 Identities = 34/93 (36%), Positives = 52/93 (55%), Gaps = 6/93 (6%)
 Frame = +2

Query: 2   SGITTCLRFPGQLNADLRKLAVNMVPFPRLHFYTPGFAPLT-SRGAQQYRALTVPELTLQ 178
           S  TT LR+PG +N DL  L  +++P PR HF   G+ PLT  R A   R  TV ++  +
Sbjct: 237 SASTTTLRYPGYMNNDLVGLLASLIPTPRCHFLMTGYTPLTVERQANVIRKTTVLDVMRR 296

Query: 179 MFDAKNMMVACDPRH-----GRYLTVATIFRGE 262
           +   KN+MV+   R+      +Y+++  I +GE
Sbjct: 297 LLQTKNIMVSSYARNKEASQAKYISILNIIQGE 329



 Score = 41.9 bits (94), Expect = 4e-04
 Identities = 28/129 (21%), Positives = 58/129 (44%), Gaps = 3/129 (2%)
 Frame = +1

Query: 118 ADVARSSTVSSFNCTRADAANVRRQKHDGRV*SSTREVFDRCDDIQGRMSMKEVDEQLAN 297
           A+V R +TV           N+    +     +S  +     + IQG +   +V E L  
Sbjct: 282 ANVIRKTTVLDVMRRLLQTKNIMVSSYARNKEASQAKYISILNIIQGEVDPTQVHESLQR 341

Query: 298 IQNKNSTYFVEWIPNNCKIAVCDIPP---RGLKMASTFIGNTTAIQTIFKRVSEQFVAMF 468
           I+ +    F++W P + ++A+    P      +++   + + T+I+ +F R   Q+  + 
Sbjct: 342 IRERKLVNFIDWGPASIQVALSKKSPYVQTSHRVSGLMLASHTSIRHLFSRCLSQYDKLR 401

Query: 469 RRKAFLHWY 495
           +++AFL  Y
Sbjct: 402 KKQAFLDNY 410


>At3g61650.1 68416.m06909 tubulin gamma-1 chain / gamma-1 tubulin
           (TUBG1) identical to SP|P38557 Tubulin gamma-1 chain
           (Gamma-1 tubulin) {Arabidopsis thaliana}
          Length = 474

 Score = 62.9 bits (146), Expect = 2e-10
 Identities = 34/93 (36%), Positives = 52/93 (55%), Gaps = 6/93 (6%)
 Frame = +2

Query: 2   SGITTCLRFPGQLNADLRKLAVNMVPFPRLHFYTPGFAPLT-SRGAQQYRALTVPELTLQ 178
           S  TT LR+PG +N DL  L  +++P PR HF   G+ PLT  R A   R  TV ++  +
Sbjct: 237 SASTTTLRYPGYMNNDLVGLLASLIPTPRCHFLMTGYTPLTVERQANVIRKTTVLDVMRR 296

Query: 179 MFDAKNMMVACDPRH-----GRYLTVATIFRGE 262
           +   KN+MV+   R+      +Y+++  I +GE
Sbjct: 297 LLQTKNIMVSSYARNKEASQAKYISILNIIQGE 329



 Score = 41.9 bits (94), Expect = 4e-04
 Identities = 28/129 (21%), Positives = 58/129 (44%), Gaps = 3/129 (2%)
 Frame = +1

Query: 118 ADVARSSTVSSFNCTRADAANVRRQKHDGRV*SSTREVFDRCDDIQGRMSMKEVDEQLAN 297
           A+V R +TV           N+    +     +S  +     + IQG +   +V E L  
Sbjct: 282 ANVIRKTTVLDVMRRLLQTKNIMVSSYARNKEASQAKYISILNIIQGEVDPTQVHESLQR 341

Query: 298 IQNKNSTYFVEWIPNNCKIAVCDIPP---RGLKMASTFIGNTTAIQTIFKRVSEQFVAMF 468
           I+ +    F+EW P + ++A+    P      +++   + + T+I+ +F +   Q+  + 
Sbjct: 342 IRERKLVNFIEWGPASIQVALSKKSPYVQTAHRVSGLMLASHTSIRHLFSKCLSQYDKLR 401

Query: 469 RRKAFLHWY 495
           +++AFL  Y
Sbjct: 402 KKQAFLDNY 410


>At3g21720.1 68416.m02740 isocitrate lyase, putative similar to
           isocitrate lyase GI:167144 from [Brassica napus]
          Length = 576

 Score = 31.1 bits (67), Expect = 0.73
 Identities = 14/33 (42%), Positives = 18/33 (54%)
 Frame = -2

Query: 265 TFAPEYRRNGQIPPVSRITRDHHVFGVEHLQRQ 167
           TFA +Y R G +  V RI R+    GV+ L  Q
Sbjct: 485 TFAKDYARRGMLAYVERIQREERTHGVDTLAHQ 517


>At3g21420.1 68416.m02703 oxidoreductase, 2OG-Fe(II) oxygenase
           family protein similar to SP|Q9ZWQ9 Flavonol synthase
           (EC 1.14.11.-) {Citrus unshiu}; contains Pfam profile
           PF03171: oxidoreductase, 2OG-Fe(II) oxygenase family
          Length = 364

 Score = 30.3 bits (65), Expect = 1.3
 Identities = 12/28 (42%), Positives = 17/28 (60%)
 Frame = -2

Query: 106 RGVEMQARKRHHVHSQLPQISVQLSRKP 23
           RGV + + K HH+H Q+P I +    KP
Sbjct: 39  RGVVVSSLKTHHLHHQIPVIDLSKLSKP 66


>At1g44900.1 68414.m05144 DNA replication licensing factor, putative
           similar to DNA replication licensing factor MCM2 from
           {Xenopus laevis} SP|P55861, SP|P49736 {Homo sapiens};
           contains Pfam profile PF00493: MCM2/3/5 family
          Length = 928

 Score = 27.5 bits (58), Expect = 9.0
 Identities = 14/52 (26%), Positives = 28/52 (53%)
 Frame = +1

Query: 205 RV*SSTREVFDRCDDIQGRMSMKEVDEQLANIQNKNSTYFVEWIPNNCKIAV 360
           R+  + RE   R D+++  ++ K  D  L  ++ KN    +E++PN C + +
Sbjct: 200 RIQGTLREWVMR-DEVRRFIAKKFKDFLLTYVKPKNENGDIEYVPNKCSLEI 250


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 14,166,787
Number of Sequences: 28952
Number of extensions: 288497
Number of successful extensions: 864
Number of sequences better than 10.0: 21
Number of HSP's better than 10.0 without gapping: 815
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 858
length of database: 12,070,560
effective HSP length: 79
effective length of database: 9,783,352
effective search space used: 1496852856
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).