SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= tesS0032
         (648 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At3g08670.1 68416.m01007 expressed protein                             28   6.1  
At5g02870.1 68418.m00230 60S ribosomal protein L4/L1 (RPL4D) 60S...    27   8.1  
At3g09630.1 68416.m01142 60S ribosomal protein L4/L1 (RPL4A) str...    27   8.1  

>At3g08670.1 68416.m01007 expressed protein 
          Length = 567

 Score = 27.9 bits (59), Expect = 6.1
 Identities = 26/89 (29%), Positives = 40/89 (44%)
 Frame = +1

Query: 181 ASXXS*LRSEEDWHKTRNSF*SXGTRSXGRGELYNGYXGRXHRTSHPLEAAADRRNPQVR 360
           AS  S  +SE  +H +R +  S  TR       Y+ +       S  L  ++   +  +R
Sbjct: 134 ASRLSVSQSESGYHSSRPARSSSVTRPSISTSQYSSFTS-GRSPSSILNTSSASVSSYIR 192

Query: 361 RQGPXDVSAQSFCSARSYAPTRLSTSSTS 447
              P   S++S  SAR   PTR S++S S
Sbjct: 193 PSSP---SSRSSSSARPSTPTRTSSASRS 218


>At5g02870.1 68418.m00230 60S ribosomal protein L4/L1 (RPL4D) 60S
           roibosomal protein L4, Arabidopsis thaliana,
           EMBL:CAA79104
          Length = 407

 Score = 27.5 bits (58), Expect = 8.1
 Identities = 13/31 (41%), Positives = 20/31 (64%)
 Frame = -1

Query: 414 VAPGGAEALGRDIVWTLSPYLRIPSISCGFQ 322
           +APGG   LGR ++WT S + ++ SI   F+
Sbjct: 247 LAPGGH--LGRFVIWTKSAFEKLESIYGSFE 275


>At3g09630.1 68416.m01142 60S ribosomal protein L4/L1 (RPL4A) strong
           similarity to 60S ribosomal protein L1 GB:P49691
          Length = 406

 Score = 27.5 bits (58), Expect = 8.1
 Identities = 13/31 (41%), Positives = 20/31 (64%)
 Frame = -1

Query: 414 VAPGGAEALGRDIVWTLSPYLRIPSISCGFQ 322
           +APGG   LGR ++WT S + ++ SI   F+
Sbjct: 246 LAPGGH--LGRFVIWTKSAFEKLESIYGSFE 274


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 11,033,707
Number of Sequences: 28952
Number of extensions: 175279
Number of successful extensions: 440
Number of sequences better than 10.0: 3
Number of HSP's better than 10.0 without gapping: 423
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 440
length of database: 12,070,560
effective HSP length: 78
effective length of database: 9,812,304
effective search space used: 1344285648
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).