SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= tesS0030
         (578 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At5g19400.1 68418.m02312 expressed protein                             27   9.0  
At3g48900.1 68416.m05342 single-strand DNA endonuclease, putativ...    27   9.0  

>At5g19400.1 68418.m02312 expressed protein
          Length = 1093

 Score = 27.1 bits (57), Expect = 9.0
 Identities = 14/35 (40%), Positives = 21/35 (60%), Gaps = 1/35 (2%)
 Frame = +2

Query: 140 NPPNQSYWFVLREDQSNVILSTNNFVNQ-NPQIPL 241
           NPP+ +   +LRE    +IL ++ F  Q N +IPL
Sbjct: 37  NPPDPNLLQLLREKYEAIILESHTFSEQHNIEIPL 71


>At3g48900.1 68416.m05342 single-strand DNA endonuclease, putative
           similar to single-strand DNA endonuclease-1 [Oryza
           sativa (japonica cultivar-group)]
           gi|16923283|dbj|BAB72003
          Length = 337

 Score = 27.1 bits (57), Expect = 9.0
 Identities = 10/21 (47%), Positives = 13/21 (61%)
 Frame = +2

Query: 161 WFVLREDQSNVILSTNNFVNQ 223
           WF+L  D  N I+S N F N+
Sbjct: 171 WFLLPSDMVNSIISPNKFANE 191


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 9,652,733
Number of Sequences: 28952
Number of extensions: 155618
Number of successful extensions: 293
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 285
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 293
length of database: 12,070,560
effective HSP length: 77
effective length of database: 9,841,256
effective search space used: 1131744440
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).