SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= tesS0029
         (499 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At4g10350.1 68417.m01700 no apical meristem (NAM) family protein...    29   1.3  
At1g31370.1 68414.m03839 expressed protein ; expression supporte...    29   1.3  
At5g04960.1 68418.m00525 pectinesterase family protein contains ...    28   3.0  
At4g29730.1 68417.m04233 WD-40 repeat family protein contains 5 ...    28   3.0  
At5g08010.1 68418.m00932 expressed protein condensin subunit SMC...    28   4.0  
At2g43700.1 68415.m05432 lectin protein kinase family protein co...    28   4.0  
At5g28500.1 68418.m03469 expressed protein predicted proteins, A...    27   5.3  
At3g10710.1 68416.m01289 pectinesterase family protein contains ...    27   7.0  
At1g03930.1 68414.m00378 protein kinase (ADK1) identical to dual...    27   7.0  
At5g19560.1 68418.m02329 hypothetical protein contains Pfam prof...    27   9.3  

>At4g10350.1 68417.m01700 no apical meristem (NAM) family protein
           contains Pfam PF02365: No apical meristem (NAM) domain;
           nap gene, Arabidopsis thaliana, gb:AJ222713
          Length = 341

 Score = 29.5 bits (63), Expect = 1.3
 Identities = 14/44 (31%), Positives = 22/44 (50%)
 Frame = -2

Query: 294 GASLGNGDSVTSNAIAVLIWVWRLTDHLTTASNGSDSSSRGTEY 163
           G  +G  ++V S+     +  W + D L T   G++ SSRG  Y
Sbjct: 265 GLDVGTCETVASHNHQQGLGEWAMMDRLVTCHMGNEDSSRGITY 308


>At1g31370.1 68414.m03839 expressed protein ; expression supported
           by MPSS
          Length = 193

 Score = 29.5 bits (63), Expect = 1.3
 Identities = 16/38 (42%), Positives = 21/38 (55%)
 Frame = -2

Query: 456 KTPFEQRVTILSGQSPTFPNIRTTTANSLQSS*RPRCH 343
           K+ FE+   I S   P  P++RTT+ NSL S     CH
Sbjct: 126 KSLFEKHPDIASKFRPKNPHLRTTSLNSLLSLTEILCH 163


>At5g04960.1 68418.m00525 pectinesterase family protein contains
           Pfam profile: PF01095 pectinesterase
          Length = 564

 Score = 28.3 bits (60), Expect = 3.0
 Identities = 13/40 (32%), Positives = 23/40 (57%), Gaps = 1/40 (2%)
 Frame = -2

Query: 333 AKLNARSTSILVRGAS-LGNGDSVTSNAIAVLIWVWRLTD 217
           A + A   S+   G + L N   +TSNA+A++ W+ ++ D
Sbjct: 177 ALVEANKPSLTTFGENHLKNSTEMTSNALAIITWLGKIAD 216


>At4g29730.1 68417.m04233 WD-40 repeat family protein contains 5
           WD-40 repeats (PF0400);  similar to WD-40 repeat protein
           MSI4 (SP:O22607) [Arabidopsis thaliana]
          Length = 496

 Score = 28.3 bits (60), Expect = 3.0
 Identities = 12/27 (44%), Positives = 17/27 (62%)
 Frame = -2

Query: 234 VWRLTDHLTTASNGSDSSSRGTEYSTT 154
           +W + DH+T A  GSDS S G+ +  T
Sbjct: 235 LWNIQDHITMA--GSDSKSPGSSFKQT 259


>At5g08010.1 68418.m00932 expressed protein condensin subunit SMC4,
           Drosophila melanogaster, EMBL:AF186472
          Length = 566

 Score = 27.9 bits (59), Expect = 4.0
 Identities = 12/27 (44%), Positives = 17/27 (62%)
 Frame = +1

Query: 28  SIPKFHSSLQDLKQPSLQEPRCLATRV 108
           ++ K  SS +DL    L+ PRCLA+ V
Sbjct: 21  NVSKGKSSSEDLTNVKLESPRCLASNV 47


>At2g43700.1 68415.m05432 lectin protein kinase family protein
           contains pfam domains PF00139: Legume lectins beta
           domain and PF00069: Protein kinase domain
          Length = 658

 Score = 27.9 bits (59), Expect = 4.0
 Identities = 19/68 (27%), Positives = 30/68 (44%), Gaps = 2/68 (2%)
 Frame = +2

Query: 254 AFEVTLSPFPSDA--PLTSMDVERALSFAPRTWHRGLQELWRLFAVVVRMLGNVGDWPLN 427
           AFE  + PF + A   +TS  V    + AP   H+G   +  + +    + G   D  L 
Sbjct: 53  AFEDEIVPFKNSANDTVTSFSVTFFFAIAPEDKHKGAHGMAFVISPTRGITGASADQYLG 112

Query: 428 IVTRCSNG 451
           I  + +NG
Sbjct: 113 IFNKANNG 120


>At5g28500.1 68418.m03469 expressed protein predicted proteins,
           Arabidopsis thaliana and Synechocystis sp.
          Length = 434

 Score = 27.5 bits (58), Expect = 5.3
 Identities = 24/74 (32%), Positives = 32/74 (43%), Gaps = 3/74 (4%)
 Frame = -3

Query: 416 SRRHFPTSEPRQRTASRALEDRGATYAERSSTRALRPYSSEERRSGTETA*LQTP-SQFS 240
           SR H   SE R     +ALE      A+++  R L   S EER    E   ++ P  +  
Sbjct: 220 SREHRSPSEIRTTLLEQALETAVTEKAKKAVLRELHGESEEERVKEEEIKIIRVPVVRLR 279

Query: 239 FG--YGGSLIT*LP 204
           FG   G S +  LP
Sbjct: 280 FGEVAGASSVVVLP 293


>At3g10710.1 68416.m01289 pectinesterase family protein contains
           similarity to pectinesterase GB:AAB57671 [Citrus
           sinensis]; contains Pfam profile: PF01095 pectinesterase
          Length = 561

 Score = 27.1 bits (57), Expect = 7.0
 Identities = 9/23 (39%), Positives = 16/23 (69%)
 Frame = -2

Query: 285 LGNGDSVTSNAIAVLIWVWRLTD 217
           L N   +TSNA+A++ W+ ++ D
Sbjct: 198 LKNSTELTSNALAIITWLGKIAD 220


>At1g03930.1 68414.m00378 protein kinase (ADK1) identical to dual
           specificity kinase 1 (ADK1) [Arabidopsis thaliana]
           gi|1216484|gb|AAB47968; supported by cDNA gi:18700076
           and gi:1216483.  Note: differences between cDNAs in the
           11th exon, possibly due to errors or alternative
           splicing.
          Length = 471

 Score = 27.1 bits (57), Expect = 7.0
 Identities = 22/69 (31%), Positives = 32/69 (46%), Gaps = 3/69 (4%)
 Frame = -3

Query: 479 RIFNTENEKHRSNSELQY*AASRRHFPTSEPRQRTASRALEDRGATY---AERSSTRALR 309
           RI   E  ++R +  ++  A SRRH  TS  R R+ASR   D   +     +    R+  
Sbjct: 329 RIAGKETRENRFSGAVE--AFSRRHPATSTTRDRSASRNSVDGPLSKHPPGDSERPRSSS 386

Query: 308 PYSSEERRS 282
            Y S  RR+
Sbjct: 387 RYGSSSRRA 395


>At5g19560.1 68418.m02329 hypothetical protein contains Pfam profile
           PF03759: Domain of unknown function (DUF315)
          Length = 493

 Score = 26.6 bits (56), Expect = 9.3
 Identities = 13/39 (33%), Positives = 21/39 (53%)
 Frame = +1

Query: 10  KSSGTSSIPKFHSSLQDLKQPSLQEPRCLATRVTGHARL 126
           K S  S I  FH   Q+ ++P ++ PR L  + +  A+L
Sbjct: 445 KHSSMSDIEFFHKVEQEKEKPMMKSPRALPKKFSYLAKL 483


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 10,034,385
Number of Sequences: 28952
Number of extensions: 173034
Number of successful extensions: 597
Number of sequences better than 10.0: 10
Number of HSP's better than 10.0 without gapping: 584
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 596
length of database: 12,070,560
effective HSP length: 76
effective length of database: 9,870,208
effective search space used: 878448512
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).