SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= tesS0027
         (429 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At1g73710.1 68414.m08535 pentatricopeptide (PPR) repeat-containi...    27   4.1  
At1g59520.3 68414.m06686 expressed protein (CW7)                       27   4.1  
At1g59520.1 68414.m06685 expressed protein (CW7)                       27   4.1  
At1g68390.1 68414.m07813 expressed protein contains Pfam profile...    27   5.4  

>At1g73710.1 68414.m08535 pentatricopeptide (PPR) repeat-containing
           protein low similarity to fertility restorer [Petunia x
           hybrida] GI:22128587, post-transcriptional control of
           chloroplast gene expression CRP1 [Zea mays] GI:3289002;
           contains Pfam profile PF01535: PPR repeat
          Length = 991

 Score = 27.5 bits (58), Expect = 4.1
 Identities = 14/35 (40%), Positives = 22/35 (62%), Gaps = 1/35 (2%)
 Frame = -3

Query: 112 CSKPAP-ERRRRIGSLRNSL*VYLNSNADVKTQAA 11
           CSKP P  R+R+ G +  S+   L+S+ D++T  A
Sbjct: 70  CSKPNPSSRKRKYGGVIPSILRSLDSSTDIETTLA 104


>At1g59520.3 68414.m06686 expressed protein (CW7)
          Length = 388

 Score = 27.5 bits (58), Expect = 4.1
 Identities = 15/48 (31%), Positives = 25/48 (52%)
 Frame = -2

Query: 212 IAGPALTMPSRMFLPIFSIFLKIFHLGSGAALVMLKASTRAKTKDRIF 69
           + GP   M S+  + + SIF K   + S AA   + A+T +  +D +F
Sbjct: 310 VLGPVSPMSSKKSIDLGSIFRKAASVASVAAKHAIAAATASYDEDEMF 357


>At1g59520.1 68414.m06685 expressed protein (CW7)
          Length = 388

 Score = 27.5 bits (58), Expect = 4.1
 Identities = 15/48 (31%), Positives = 25/48 (52%)
 Frame = -2

Query: 212 IAGPALTMPSRMFLPIFSIFLKIFHLGSGAALVMLKASTRAKTKDRIF 69
           + GP   M S+  + + SIF K   + S AA   + A+T +  +D +F
Sbjct: 310 VLGPVSPMSSKKSIDLGSIFRKAASVASVAAKHAIAAATASYDEDEMF 357


>At1g68390.1 68414.m07813 expressed protein contains Pfam profile
           PF03267: Arabidopsis protein of unknown function,
           DUF266; expression supported by MPSS
          Length = 408

 Score = 27.1 bits (57), Expect = 5.4
 Identities = 12/33 (36%), Positives = 18/33 (54%)
 Frame = +3

Query: 273 YSLILICNLITALRLNNKTFNFKYNLKLMSAKV 371
           YSLIL C +I  + L++   NF  N  L   ++
Sbjct: 37  YSLILCCGIIIGILLHSSLQNFSSNSSLSIQRI 69


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 8,346,601
Number of Sequences: 28952
Number of extensions: 159010
Number of successful extensions: 356
Number of sequences better than 10.0: 4
Number of HSP's better than 10.0 without gapping: 352
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 356
length of database: 12,070,560
effective HSP length: 74
effective length of database: 9,928,112
effective search space used: 675111616
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).