SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= tesS0026
         (399 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At4g15840.1 68417.m02409 expressed protein                             29   0.86 
At2g21300.1 68415.m02535 kinesin motor family protein contains P...    27   3.5  
At5g07790.1 68418.m00892 expressed protein                             27   4.6  
At4g03610.1 68417.m00496 phosphonate metabolism protein-related ...    26   8.0  

>At4g15840.1 68417.m02409 expressed protein
          Length = 660

 Score = 29.5 bits (63), Expect = 0.86
 Identities = 14/31 (45%), Positives = 17/31 (54%)
 Frame = +1

Query: 142 ISGSRARFQLSGNSGRKHSRCCTSILRKFSG 234
           +SGS   FQ S NS     R CTS++ K  G
Sbjct: 115 VSGSNLVFQQSSNSQTNFGRPCTSVVDKTEG 145


>At2g21300.1 68415.m02535 kinesin motor family protein contains Pfam
           profile: kinesin motor domain PF00225
          Length = 862

 Score = 27.5 bits (58), Expect = 3.5
 Identities = 15/33 (45%), Positives = 16/33 (48%)
 Frame = +1

Query: 52  KLKEHGASSCISGKRGRRCCNIWHWGSVDSISG 150
           K+ EH ASS       R   N W  GSV  ISG
Sbjct: 425 KMVEHDASSKAGTPHFRNRTNKWEDGSVSEISG 457


>At5g07790.1 68418.m00892 expressed protein
          Length = 616

 Score = 27.1 bits (57), Expect = 4.6
 Identities = 15/48 (31%), Positives = 24/48 (50%)
 Frame = +1

Query: 73  SSCISGKRGRRCCNIWHWGSVDSISGSRARFQLSGNSGRKHSRCCTSI 216
           S  +  KR RR   +   G+   +S + A   +S  SGR+ + C TS+
Sbjct: 411 SGRVKRKRSRRISLVAE-GNYQQVSAAEAIVDISRKSGRETAACITSL 457


>At4g03610.1 68417.m00496 phosphonate metabolism protein-related
           weak similarity to PhnP protein. (Swiss-Prot:P16692)
           [Escherichia coli]
          Length = 290

 Score = 26.2 bits (55), Expect = 8.0
 Identities = 13/51 (25%), Positives = 23/51 (45%), Gaps = 4/51 (7%)
 Frame = -2

Query: 146 LMESTDPQCHILQHRRPRLPLMQLEAPCS----FNFCSLRAIRRYKSYYVD 6
           L++ +DP CH+       LP +     C+     ++CS     R+K   +D
Sbjct: 30  LLQPSDPPCHVCSQSLSLLPHLNPNYRCNTSLLIDYCSKEEDGRHKYILID 80


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 7,664,408
Number of Sequences: 28952
Number of extensions: 130185
Number of successful extensions: 271
Number of sequences better than 10.0: 4
Number of HSP's better than 10.0 without gapping: 270
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 271
length of database: 12,070,560
effective HSP length: 74
effective length of database: 9,928,112
effective search space used: 575830496
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).