SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= tesS0025
         (598 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At1g59660.1 68414.m06710 nucleoporin family protein contains Pfa...    35   0.047
At4g20110.1 68417.m02943 vacuolar sorting receptor, putative sim...    31   0.44 
At1g15780.1 68414.m01893 expressed protein                             31   0.58 
At2g14740.2 68415.m01663 vacuolar sorting receptor, putative nea...    30   1.0  
At2g14740.1 68415.m01662 vacuolar sorting receptor, putative nea...    30   1.0  
At2g14720.2 68415.m01657 vacuolar sorting receptor, putative ide...    30   1.0  
At2g14720.1 68415.m01656 vacuolar sorting receptor, putative ide...    30   1.0  
At1g30900.1 68414.m03780 vacuolar sorting receptor, putative sim...    30   1.3  
At2g30290.1 68415.m03687 vacuolar sorting receptor, putative sim...    29   2.4  
At3g52850.1 68416.m05824 vacuolar sorting receptor, putative nea...    29   3.1  
At1g61140.1 68414.m06888 SNF2 domain-containing protein / helica...    29   3.1  
At1g07720.1 68414.m00832 beta-ketoacyl-CoA synthase family prote...    29   3.1  
At2g34940.1 68415.m04289 vacuolar sorting receptor, putative sim...    28   4.1  
At2g30480.2 68415.m03713 expressed protein                             27   7.2  
At2g30480.1 68415.m03712 expressed protein                             27   7.2  
At1g60900.1 68414.m06856 U2 snRNP auxiliary factor large subunit...    27   9.5  

>At1g59660.1 68414.m06710 nucleoporin family protein contains Pfam
           profiles: PF04096 nucleoporin autopeptidase, PF03093
           nucleoporin FG repeat family
          Length = 997

 Score = 34.7 bits (76), Expect = 0.047
 Identities = 23/53 (43%), Positives = 27/53 (50%)
 Frame = -1

Query: 466 TTAGFGSFCWPFHGLSGNSSPGCPLVCTILSPFTSTTQRNRAQHVGNSTFSSS 308
           +T  FGS   PF G S        L     SPF STTQ+++    GNSTF SS
Sbjct: 94  STPSFGSSNSPFGGTSTFGQKSFGLSTPQSSPFGSTTQQSQPA-FGNSTFGSS 145


>At4g20110.1 68417.m02943 vacuolar sorting receptor, putative
           similar to BP-80 vacuolar sorting receptor [Pisum
           sativum] GI:1737222; identical to vacuolar sorting
           receptor-like protein (GI:2827665) [Arabidopsis
           thaliana]
          Length = 625

 Score = 31.5 bits (68), Expect = 0.44
 Identities = 13/38 (34%), Positives = 21/38 (55%)
 Frame = +1

Query: 133 QACVDKYSRKGYQPWQEWSDHYTCHRYRCEIRDGKYFI 246
           Q CV + + +  +PW  W D+ T    RC +++ KY I
Sbjct: 284 QLCVHRVANESSRPWVWW-DYVTDFHSRCSMKEKKYSI 320


>At1g15780.1 68414.m01893 expressed protein
          Length = 1335

 Score = 31.1 bits (67), Expect = 0.58
 Identities = 19/55 (34%), Positives = 31/55 (56%)
 Frame = +3

Query: 156 QERLPAVARVVGSLHVPPLQMRDQRREILHSCCGCRKPKIPENALECHEYIEDEN 320
           Q+RL A  +V GSL +PP  + DQ+R++  S      P++P ++L+     E  N
Sbjct: 538 QQRLQASGQVTGSL-LPPQNVVDQQRQLYQS--QRTLPEMPSSSLDSTAQTESAN 589


>At2g14740.2 68415.m01663 vacuolar sorting receptor, putative nearly
           identical to vacuolar sorting receptor homolog
           [Arabidopsis thaliana] GI:1737220; contains a
           calcium-binding EGF-like domain signature
          Length = 628

 Score = 30.3 bits (65), Expect = 1.0
 Identities = 13/36 (36%), Positives = 21/36 (58%)
 Frame = +1

Query: 133 QACVDKYSRKGYQPWQEWSDHYTCHRYRCEIRDGKY 240
           Q CV K + +  +PW  W D+ T  + RC +++ KY
Sbjct: 286 QLCVYKVANETGKPWVWW-DYVTDFQIRCPMKEKKY 320


>At2g14740.1 68415.m01662 vacuolar sorting receptor, putative nearly
           identical to vacuolar sorting receptor homolog
           [Arabidopsis thaliana] GI:1737220; contains a
           calcium-binding EGF-like domain signature
          Length = 628

 Score = 30.3 bits (65), Expect = 1.0
 Identities = 13/36 (36%), Positives = 21/36 (58%)
 Frame = +1

Query: 133 QACVDKYSRKGYQPWQEWSDHYTCHRYRCEIRDGKY 240
           Q CV K + +  +PW  W D+ T  + RC +++ KY
Sbjct: 286 QLCVYKVANETGKPWVWW-DYVTDFQIRCPMKEKKY 320


>At2g14720.2 68415.m01657 vacuolar sorting receptor, putative
           identical to GB:U79960 GI:1737220; contains a
           calcium-binding EGF-like domain signature
          Length = 628

 Score = 30.3 bits (65), Expect = 1.0
 Identities = 13/36 (36%), Positives = 21/36 (58%)
 Frame = +1

Query: 133 QACVDKYSRKGYQPWQEWSDHYTCHRYRCEIRDGKY 240
           Q CV K + +  +PW  W D+ T  + RC +++ KY
Sbjct: 286 QLCVYKVANETGKPWVWW-DYVTDFQIRCPMKEKKY 320


>At2g14720.1 68415.m01656 vacuolar sorting receptor, putative
           identical to GB:U79960 GI:1737220; contains a
           calcium-binding EGF-like domain signature
          Length = 628

 Score = 30.3 bits (65), Expect = 1.0
 Identities = 13/36 (36%), Positives = 21/36 (58%)
 Frame = +1

Query: 133 QACVDKYSRKGYQPWQEWSDHYTCHRYRCEIRDGKY 240
           Q CV K + +  +PW  W D+ T  + RC +++ KY
Sbjct: 286 QLCVYKVANETGKPWVWW-DYVTDFQIRCPMKEKKY 320


>At1g30900.1 68414.m03780 vacuolar sorting receptor, putative
           similar to BP-80 vacuolar sorting receptor [Pisum
           sativum] GI:1737222
          Length = 631

 Score = 29.9 bits (64), Expect = 1.3
 Identities = 12/36 (33%), Positives = 20/36 (55%)
 Frame = +1

Query: 133 QACVDKYSRKGYQPWQEWSDHYTCHRYRCEIRDGKY 240
           Q CV K +++  + W  W D+ T    RC +++ KY
Sbjct: 283 QLCVHKVAKENNRSWVWW-DYVTDFHIRCSMKEKKY 317


>At2g30290.1 68415.m03687 vacuolar sorting receptor, putative
           similar to vacuolar sorting receptor homolog
           [Arabidopsis thaliana] GI:1737218
          Length = 625

 Score = 29.1 bits (62), Expect = 2.4
 Identities = 12/36 (33%), Positives = 20/36 (55%)
 Frame = +1

Query: 133 QACVDKYSRKGYQPWQEWSDHYTCHRYRCEIRDGKY 240
           QAC  + + +  +PW  W D+ T    RC +++ KY
Sbjct: 285 QACFFRVTNESGKPWLWW-DYVTDFAIRCPMKEEKY 319


>At3g52850.1 68416.m05824 vacuolar sorting receptor, putative nearly
           identical to vacuolar sorting receptor homolog
           (GP:1737218) [Arabidopsis thaliana]
          Length = 623

 Score = 28.7 bits (61), Expect = 3.1
 Identities = 13/36 (36%), Positives = 19/36 (52%)
 Frame = +1

Query: 133 QACVDKYSRKGYQPWQEWSDHYTCHRYRCEIRDGKY 240
           QACV +      +PW  W D+ T    RC +++ KY
Sbjct: 281 QACVYRVMNDTGKPWVWW-DYVTDFAIRCPMKEKKY 315


>At1g61140.1 68414.m06888 SNF2 domain-containing protein / helicase
           domain-containing protein / zinc finger protein-related
           similar to ATPase [Homo sapiens] GI:531196; contains
           Pfam profiles PF00271: Helicase conserved C-terminal
           domain, PF00176: SNF2 family N-terminal domain, PF00097:
           Zinc finger, C3HC4 type (RING finger)
          Length = 1287

 Score = 28.7 bits (61), Expect = 3.1
 Identities = 14/49 (28%), Positives = 25/49 (51%), Gaps = 8/49 (16%)
 Frame = -2

Query: 357 RNAIAHSTWGIRHSHLRCIRGIPVRFPV--------FLVFDIHSSYEVF 235
           +  +A + WG+R     C+ G P++  +        FL +D +SSY +F
Sbjct: 809 KTQVARACWGLRAKRRWCLSGTPIQNSIDDLYSYFRFLKYDPYSSYVLF 857


>At1g07720.1 68414.m00832 beta-ketoacyl-CoA synthase family protein
           similar to GB:AAC99312 from [Arabidopsis thaliana]
           (Plant J. (1999) In press)
          Length = 478

 Score = 28.7 bits (61), Expect = 3.1
 Identities = 14/32 (43%), Positives = 17/32 (53%)
 Frame = +1

Query: 73  ALFMLCCLVLPALSAEDVSYQACVDKYSRKGY 168
           A+F L CLV     A D S+ ACV K    G+
Sbjct: 236 AMFKLRCLVRTHHGARDDSFNACVQKEDELGH 267


>At2g34940.1 68415.m04289 vacuolar sorting receptor, putative
           similar to BP-80 vacuolar sorting receptor [Pisum
           sativum] GI:1737222
          Length = 618

 Score = 28.3 bits (60), Expect = 4.1
 Identities = 12/36 (33%), Positives = 19/36 (52%)
 Frame = +1

Query: 133 QACVDKYSRKGYQPWQEWSDHYTCHRYRCEIRDGKY 240
           Q CV K +++    W  W D+ T    RC +++ KY
Sbjct: 282 QLCVHKVAKEKNTSWVWW-DYVTDFNIRCSMKEKKY 316


>At2g30480.2 68415.m03713 expressed protein
          Length = 566

 Score = 27.5 bits (58), Expect = 7.2
 Identities = 17/62 (27%), Positives = 30/62 (48%), Gaps = 2/62 (3%)
 Frame = +1

Query: 118 EDVSYQACVDKYSRKG--YQPWQEWSDHYTCHRYRCEIRDGKYFIAAVDVENQKYRKTHW 291
           +D  Y++ +  +++ G   Q  Q +SDH   H+   + R+  YF    D  N ++    W
Sbjct: 168 DDSLYRSPIGIHAKDGGRKQKLQTFSDHL--HKQYSDSRN--YFCDVADFNNSRFSDDEW 223

Query: 292 NA 297
           NA
Sbjct: 224 NA 225


>At2g30480.1 68415.m03712 expressed protein
          Length = 621

 Score = 27.5 bits (58), Expect = 7.2
 Identities = 17/62 (27%), Positives = 30/62 (48%), Gaps = 2/62 (3%)
 Frame = +1

Query: 118 EDVSYQACVDKYSRKG--YQPWQEWSDHYTCHRYRCEIRDGKYFIAAVDVENQKYRKTHW 291
           +D  Y++ +  +++ G   Q  Q +SDH   H+   + R+  YF    D  N ++    W
Sbjct: 168 DDSLYRSPIGIHAKDGGRKQKLQTFSDHL--HKQYSDSRN--YFCDVADFNNSRFSDDEW 223

Query: 292 NA 297
           NA
Sbjct: 224 NA 225


>At1g60900.1 68414.m06856 U2 snRNP auxiliary factor large subunit,
           putative similar to U2 snRNP auxiliary factor, large
           subunit GB:CAA77136 from [Nicotiana plumbaginifolia]
          Length = 589

 Score = 27.1 bits (57), Expect = 9.5
 Identities = 13/35 (37%), Positives = 19/35 (54%)
 Frame = -2

Query: 252 SSYEVFPVSDLASVAVARVVIRPLLPRLVTFPGVF 148
           S +++ P   LA+ AVA     P +P   T PG+F
Sbjct: 189 SGFDMAPPDMLAATAVAAAGQVPSVPTTATIPGMF 223


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 14,113,247
Number of Sequences: 28952
Number of extensions: 314705
Number of successful extensions: 964
Number of sequences better than 10.0: 16
Number of HSP's better than 10.0 without gapping: 940
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 963
length of database: 12,070,560
effective HSP length: 77
effective length of database: 9,841,256
effective search space used: 1190791976
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).