SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= tesS0023
         (289 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At3g60245.1 68416.m06733 60S ribosomal protein L37a (RPL37aC)         119   3e-28
At3g10950.1 68416.m01320 60S ribosomal protein L37a (RPL37aB) si...   112   3e-26
At2g32770.3 68415.m04011 purple acid phosphatase (PAP13) identic...    30   0.22 
At2g32770.2 68415.m04012 purple acid phosphatase (PAP13) identic...    30   0.22 
At2g32770.1 68415.m04010 purple acid phosphatase (PAP13) identic...    30   0.22 
At4g28730.1 68417.m04109 glutaredoxin family protein contains gl...    27   1.6  
At4g38600.2 68417.m05463 HECT-domain-containing protein / ubiqui...    27   2.8  
At4g38600.1 68417.m05464 HECT-domain-containing protein / ubiqui...    27   2.8  
At2g02620.1 68415.m00201 DC1 domain-containing protein / PHD fin...    27   2.8  
At5g58930.1 68418.m07382 expressed protein contains Pfam PF05340...    25   6.4  
At3g18290.1 68416.m02326 zinc finger protein-related weak alignm...    25   6.4  
At5g43930.1 68418.m05374 transducin family protein / WD-40 repea...    25   8.4  
At2g28650.1 68415.m03483 exocyst subunit EXO70 family protein co...    25   8.4  
At1g19570.1 68414.m02437 dehydroascorbate reductase, putative si...    25   8.4  

>At3g60245.1 68416.m06733 60S ribosomal protein L37a (RPL37aC)
          Length = 92

 Score =  119 bits (287), Expect = 3e-28
 Identities = 51/76 (67%), Positives = 60/76 (78%)
 Frame = +2

Query: 26  MAKRTKKVGITGKYGTRYGASLRKMVKKMEVTQHAKYTCSFCGKDAMKRSCVGIWSCKRC 205
           MAKRTKKVGI GKYGTRYGAS+RK +KKMEV+QH+KY C FCGK  +KR  VGIW CK C
Sbjct: 1   MAKRTKKVGIVGKYGTRYGASIRKQIKKMEVSQHSKYFCEFCGKYGVKRKAVGIWGCKDC 60

Query: 206 KRTVAGGAWVFSTTAA 253
            +  AGGA+  +T +A
Sbjct: 61  GKVKAGGAYTMNTASA 76


>At3g10950.1 68416.m01320 60S ribosomal protein L37a (RPL37aB)
           similar to putative 60S ribosomal protein L37a
           GB:AAD28753 [Gossypium hirsutum]
          Length = 92

 Score =  112 bits (270), Expect = 3e-26
 Identities = 49/76 (64%), Positives = 57/76 (75%)
 Frame = +2

Query: 26  MAKRTKKVGITGKYGTRYGASLRKMVKKMEVTQHAKYTCSFCGKDAMKRSCVGIWSCKRC 205
           M KRTKK  I GKYGTRYGASLRK +KKMEV+QH KY C FCGK ++KR  VGIW CK C
Sbjct: 1   MTKRTKKARIVGKYGTRYGASLRKQIKKMEVSQHNKYFCEFCGKYSVKRKVVGIWGCKDC 60

Query: 206 KRTVAGGAWVFSTTAA 253
            +  AGGA+  +T +A
Sbjct: 61  GKVKAGGAYTMNTASA 76


>At2g32770.3 68415.m04011 purple acid phosphatase (PAP13) identical
           to purple acid phosphatase (PAP13) [Arabidopsis
           thaliana] GI:20257489; contains Pfam profile PF00149:
           Ser/Thr protein phosphatase
          Length = 545

 Score = 30.3 bits (65), Expect = 0.22
 Identities = 9/17 (52%), Positives = 12/17 (70%)
 Frame = +1

Query: 10  GEVYQNGQTYQKGWNYW 60
           G  Y +G+TYQ  W+YW
Sbjct: 261 GSCYSSGETYQPRWDYW 277


>At2g32770.2 68415.m04012 purple acid phosphatase (PAP13) identical
           to purple acid phosphatase (PAP13) [Arabidopsis
           thaliana] GI:20257489; contains Pfam profile PF00149:
           Ser/Thr protein phosphatase
          Length = 428

 Score = 30.3 bits (65), Expect = 0.22
 Identities = 9/17 (52%), Positives = 12/17 (70%)
 Frame = +1

Query: 10  GEVYQNGQTYQKGWNYW 60
           G  Y +G+TYQ  W+YW
Sbjct: 180 GSCYSSGETYQPRWDYW 196


>At2g32770.1 68415.m04010 purple acid phosphatase (PAP13) identical
           to purple acid phosphatase (PAP13) [Arabidopsis
           thaliana] GI:20257489; contains Pfam profile PF00149:
           Ser/Thr protein phosphatase
          Length = 516

 Score = 30.3 bits (65), Expect = 0.22
 Identities = 9/17 (52%), Positives = 12/17 (70%)
 Frame = +1

Query: 10  GEVYQNGQTYQKGWNYW 60
           G  Y +G+TYQ  W+YW
Sbjct: 261 GSCYSSGETYQPRWDYW 277


>At4g28730.1 68417.m04109 glutaredoxin family protein contains
           glutaredoxin domain, Pfam:PF00462
          Length = 174

 Score = 27.5 bits (58), Expect = 1.6
 Identities = 11/32 (34%), Positives = 19/32 (59%)
 Frame = +2

Query: 56  TGKYGTRYGASLRKMVKKMEVTQHAKYTCSFC 151
           +  +G+R   S+RK V +  V  ++K  CS+C
Sbjct: 62  SSSFGSRMEESIRKTVTENTVVIYSKTWCSYC 93


>At4g38600.2 68417.m05463 HECT-domain-containing protein /
           ubiquitin-transferase family protein similar to
           SP|Q14669Thyroid receptor interacting protein 12
           (TRIP12) {Homo sapiens}; contains Pfam profile PF00632:
           HECT-domain (ubiquitin-transferase)
          Length = 1794

 Score = 26.6 bits (56), Expect = 2.8
 Identities = 10/22 (45%), Positives = 16/22 (72%)
 Frame = -2

Query: 231 QAPPATVLLHRLQDQMPTQERF 166
           + PP TVL+ +LQ+ + + ERF
Sbjct: 802 KVPPMTVLIQKLQNALSSLERF 823


>At4g38600.1 68417.m05464 HECT-domain-containing protein /
           ubiquitin-transferase family protein similar to
           SP|Q14669Thyroid receptor interacting protein 12
           (TRIP12) {Homo sapiens}; contains Pfam profile PF00632:
           HECT-domain (ubiquitin-transferase)
          Length = 1888

 Score = 26.6 bits (56), Expect = 2.8
 Identities = 10/22 (45%), Positives = 16/22 (72%)
 Frame = -2

Query: 231 QAPPATVLLHRLQDQMPTQERF 166
           + PP TVL+ +LQ+ + + ERF
Sbjct: 875 KVPPMTVLIQKLQNALSSLERF 896


>At2g02620.1 68415.m00201 DC1 domain-containing protein / PHD finger
           protein-related contains Pfam profiles PF03107: DC1
           domain, weak hit to PF00628: PHD-finger
          Length = 513

 Score = 26.6 bits (56), Expect = 2.8
 Identities = 10/28 (35%), Positives = 18/28 (64%), Gaps = 2/28 (7%)
 Frame = +2

Query: 179 VGIWSCKRCKRTVAG--GAWVFSTTAAY 256
           +GIWSC  C++ + G  GA++ +  + Y
Sbjct: 163 LGIWSCGVCRKEIDGDYGAYICNICSGY 190


>At5g58930.1 68418.m07382 expressed protein contains Pfam PF05340:
           Protein of unknown function (DUF740)
          Length = 521

 Score = 25.4 bits (53), Expect = 6.4
 Identities = 6/13 (46%), Positives = 11/13 (84%)
 Frame = +1

Query: 22  QNGQTYQKGWNYW 60
           ++G+ + KGWN+W
Sbjct: 347 KSGKNWSKGWNFW 359


>At3g18290.1 68416.m02326 zinc finger protein-related weak alignment
           to Pfam profiles: PF00097 Zinc finger, C3HC4 type (RING
           finger) (2 copies)
          Length = 1254

 Score = 25.4 bits (53), Expect = 6.4
 Identities = 12/43 (27%), Positives = 20/43 (46%)
 Frame = -2

Query: 240 ENTQAPPATVLLHRLQDQMPTQERFIASLPQNEQVYFACWVTS 112
           E  Q  P  +   + ++Q     RF+ S+P N    F  W++S
Sbjct: 177 EQKQVFPLLIEKFKYEEQAYIVWRFLCSIPVNMLAVFLPWISS 219


>At5g43930.1 68418.m05374 transducin family protein / WD-40 repeat
           family protein contains 4 WD-40 repeats (PF00400);
           similar to WD-repeat protein 5 (SP:Q9UGP9) [Homo
           sapiens]
          Length = 726

 Score = 25.0 bits (52), Expect = 8.4
 Identities = 10/21 (47%), Positives = 13/21 (61%)
 Frame = +2

Query: 65  YGTRYGASLRKMVKKMEVTQH 127
           YG R+G+ LR +V   E T H
Sbjct: 640 YGRRHGSLLRSIVSDGETTSH 660


>At2g28650.1 68415.m03483 exocyst subunit EXO70 family protein
           contains Pfam domain PF03081: Exo70 exocyst complex
           subunit
          Length = 573

 Score = 25.0 bits (52), Expect = 8.4
 Identities = 18/72 (25%), Positives = 38/72 (52%)
 Frame = -2

Query: 216 TVLLHRLQDQMPTQERFIASLPQNEQVYFACWVTSIFLTILRREAP*RVPYLPVIPTFLV 37
           +++ H ++D      R+I+  P++      C+++S+F T  R EA   +  +  + + ++
Sbjct: 27  SLMEHTIEDAESIIHRWIS--PEHVHSSSFCFISSLFSTENREEAKRFIDAVTTLHSGMI 84

Query: 36  RLAILVNLSDTK 1
           RL I VN +  K
Sbjct: 85  RL-ISVNPTSMK 95


>At1g19570.1 68414.m02437 dehydroascorbate reductase, putative
           similar to GB:BAA90672 from (Oryza sativa)
          Length = 213

 Score = 25.0 bits (52), Expect = 8.4
 Identities = 14/21 (66%), Positives = 15/21 (71%), Gaps = 1/21 (4%)
 Frame = -1

Query: 76  TCAIFAS-NSNLFGTFGHFGK 17
           T A FAS  SN+FGTFG F K
Sbjct: 91  TPAEFASVGSNIFGTFGTFLK 111


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 7,054,415
Number of Sequences: 28952
Number of extensions: 142798
Number of successful extensions: 424
Number of sequences better than 10.0: 14
Number of HSP's better than 10.0 without gapping: 416
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 424
length of database: 12,070,560
effective HSP length: 69
effective length of database: 10,072,872
effective search space used: 261894672
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).