SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= tesS0018
         (678 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At2g42230.2 68415.m05226 tubulin-specific chaperone C-related we...    29   3.7  
At2g42230.1 68415.m05227 tubulin-specific chaperone C-related we...    29   3.7  
At2g41700.1 68415.m05151 ABC transporter family protein similar ...    29   3.7  
At1g35890.1 68414.m04458 hypothetical protein                          29   3.7  
At3g57890.1 68416.m06453 tubulin-specific chaperone C-related co...    28   4.9  
At5g48600.1 68418.m06011 structural maintenance of chromosomes (...    28   6.5  
At2g26550.1 68415.m03185 heme oxygenase 2 (HO2) similar to heme ...    27   8.6  
At1g13330.1 68414.m01547 expressed protein similar to nuclear re...    27   8.6  

>At2g42230.2 68415.m05226 tubulin-specific chaperone C-related weak
           similarity to Tubulin-specific chaperone C
           (Tubulin-folding cofactor C) (CFC) (Swiss-Prot:Q15814)
           [Homo sapiens]
          Length = 568

 Score = 28.7 bits (61), Expect = 3.7
 Identities = 15/38 (39%), Positives = 22/38 (57%), Gaps = 1/38 (2%)
 Frame = +1

Query: 214 VLKASSTIGGYLSSVC-ISTVRRNKKRFMLCSQEKEKH 324
           V  ++S   GYLS++  I  VR N +RFM    ++E H
Sbjct: 144 VWPSTSAFDGYLSALSPIQLVRSNSRRFMPSPTDEEAH 181


>At2g42230.1 68415.m05227 tubulin-specific chaperone C-related weak
           similarity to Tubulin-specific chaperone C
           (Tubulin-folding cofactor C) (CFC) (Swiss-Prot:Q15814)
           [Homo sapiens]
          Length = 562

 Score = 28.7 bits (61), Expect = 3.7
 Identities = 15/38 (39%), Positives = 22/38 (57%), Gaps = 1/38 (2%)
 Frame = +1

Query: 214 VLKASSTIGGYLSSVC-ISTVRRNKKRFMLCSQEKEKH 324
           V  ++S   GYLS++  I  VR N +RFM    ++E H
Sbjct: 144 VWPSTSAFDGYLSALSPIQLVRSNSRRFMPSPTDEEAH 181


>At2g41700.1 68415.m05151 ABC transporter family protein similar to
            ATP-binding cassette transporter ABCA1 GI:18031705 from
            [Arabidopsis thaliana]
          Length = 1822

 Score = 28.7 bits (61), Expect = 3.7
 Identities = 25/79 (31%), Positives = 42/79 (53%), Gaps = 1/79 (1%)
 Frame = -2

Query: 368  DFVSS*LLI*LAMAVCFSFSWEQSMNLFLFLRTVLMQTLERYPPIVELAFRTDYCIL*KF 189
            DF+S       A+ + ++F  EQ + +  FL TVLM  L  Y   + +A  T YC+   F
Sbjct: 1161 DFISFLFPSTFAIILFYAFGLEQFIGIGRFLPTVLM--LLEYG--LAIASST-YCLTFFF 1215

Query: 188  AHHSL-EVT*SFAVVVYVI 135
              HS+ + T S++ V+ ++
Sbjct: 1216 TEHSMAQATSSYSNVILMV 1234


>At1g35890.1 68414.m04458 hypothetical protein
          Length = 171

 Score = 28.7 bits (61), Expect = 3.7
 Identities = 18/51 (35%), Positives = 26/51 (50%), Gaps = 4/51 (7%)
 Frame = -3

Query: 235 SSSLLSGPITVFCESLLTIVLRSPKVLPWSF----TSSCNLSSFFSKCLKE 95
           +S L   PI + CESLL   L   + L W      +SSC+++   S+  KE
Sbjct: 120 TSYLEQQPINIECESLLAAYLEQEQPLLWDVPNKSSSSCSVAETESRMEKE 170


>At3g57890.1 68416.m06453 tubulin-specific chaperone C-related
           contains weak similarity to Tubulin-specific chaperone C
           (Tubulin-folding cofactor C) (CFC) (Swiss-Prot:Q15814)
           [Homo sapiens]
          Length = 573

 Score = 28.3 bits (60), Expect = 4.9
 Identities = 15/38 (39%), Positives = 21/38 (55%), Gaps = 1/38 (2%)
 Frame = +1

Query: 214 VLKASSTIGGYLSSVC-ISTVRRNKKRFMLCSQEKEKH 324
           V  ++S   GYLS++  I  VR N +RFM    + E H
Sbjct: 151 VWPSTSAFDGYLSALSPIQLVRSNSRRFMPSQADDEAH 188


>At5g48600.1 68418.m06011 structural maintenance of chromosomes
           (SMC) family protein similar to SP|P50532 Chromosome
           assembly protein XCAP-C {Xenopus laevis}; contains Pfam
           profiles PF02483: SMC family C-terminal domain, PF02463:
           RecF/RecN/SMC N terminal domain
          Length = 1241

 Score = 27.9 bits (59), Expect = 6.5
 Identities = 21/75 (28%), Positives = 37/75 (49%)
 Frame = +3

Query: 102 KHFEKKLDKLQDDVNDHGKTLGDLKTMVSKLSQNTVIGPESKLDDWRVPFKRLHQYSTKK 281
           KH ++K+ KL+D +      +GD+ T  S+ S N +     KL +     +++     KK
Sbjct: 347 KHVKQKIKKLEDKLEKDSSKIGDM-TKESEDSSNLI----PKLQENIPKLQKVLLDEEKK 401

Query: 282 QKEIHALFPRERKTY 326
            +EI A+   E + Y
Sbjct: 402 LEEIKAIAKVETEGY 416


>At2g26550.1 68415.m03185 heme oxygenase 2 (HO2) similar to heme
           oxygenase 2 [Arabidopsis thaliana]
           gi|4530595|gb|AAD22109
          Length = 354

 Score = 27.5 bits (58), Expect = 8.6
 Identities = 16/62 (25%), Positives = 30/62 (48%)
 Frame = +2

Query: 323 IQPLPIKSKAKSLQNQNIIEAAFPISVPPKIIRKRSPRTRKVETPRKTPTLRSHKGLENK 502
           ++P P+ S  + L + ++  +   IS P +I  +R P+   +   R TPT    K  + K
Sbjct: 5   LRPTPLLSTPRKLTHSHLHTS---ISFPFQISTQRKPQKHLLNLCRSTPTPSQQKASQRK 61

Query: 503 HS 508
            +
Sbjct: 62  RT 63


>At1g13330.1 68414.m01547 expressed protein similar to nuclear
           receptor coactivator GT198 (GI:16506273) {Rattus
           norvegicus}; similar to TBP-1 interacting protein
           (GI:7328534) [Homo sapiens]
          Length = 226

 Score = 27.5 bits (58), Expect = 8.6
 Identities = 15/66 (22%), Positives = 32/66 (48%), Gaps = 1/66 (1%)
 Frame = +3

Query: 126 KLQDDVNDHGKTLGDLKTMVSKLSQNTVIGPESKLD-DWRVPFKRLHQYSTKKQKEIHAL 302
           KLQ+ + +  KT+ D+++ +  L  N  +    + D   R   K + +   K ++ I  +
Sbjct: 90  KLQEQLQEKKKTISDVESEIKSLQSNLTLEEIQEKDAKLRKEVKEMEEKLVKLREGITLV 149

Query: 303 FPRERK 320
            P ++K
Sbjct: 150 RPEDKK 155


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 12,694,791
Number of Sequences: 28952
Number of extensions: 239955
Number of successful extensions: 769
Number of sequences better than 10.0: 8
Number of HSP's better than 10.0 without gapping: 753
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 769
length of database: 12,070,560
effective HSP length: 79
effective length of database: 9,783,352
effective search space used: 1428369392
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).