SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= tesS0017
         (698 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At1g53645.1 68414.m06102 hydroxyproline-rich glycoprotein family...    29   3.0  
At5g66300.1 68418.m08359 no apical meristem (NAM) family protein...    27   9.0  
At5g19530.1 68418.m02326 spermine/spermidine synthase family pro...    27   9.0  

>At1g53645.1 68414.m06102 hydroxyproline-rich glycoprotein family
           protein
          Length = 523

 Score = 29.1 bits (62), Expect = 3.0
 Identities = 18/48 (37%), Positives = 24/48 (50%), Gaps = 2/48 (4%)
 Frame = +1

Query: 229 PNSTSRDKIVVETGENRQFIH--INEPPIIVQEHDSQPQEKVCSTTKD 366
           P+   R K +VE+   RQ  +  I  PP   Q+   QPQ+K   T KD
Sbjct: 214 PSGAGRGKPLVESAPIRQEDNRQIRRPPPPPQQQRVQPQQKRAPTVKD 261


>At5g66300.1 68418.m08359 no apical meristem (NAM) family protein
           similar to NAC2 (GI:6456751)  [Arabidopsis thaliana];
           contains Pfam PF02365 : No apical meristem (NAM) protein
          Length = 292

 Score = 27.5 bits (58), Expect = 9.0
 Identities = 10/34 (29%), Positives = 17/34 (50%)
 Frame = +2

Query: 104 LFRYFSLKMDMNNPPNQSYWFVLREDQSNVILST 205
           +  Y+SL+   N+PP +  W V R  +    + T
Sbjct: 135 IHEYYSLESHQNSPPQEEGWVVCRAFKKRTTIPT 168


>At5g19530.1 68418.m02326 spermine/spermidine synthase family
           protein similar to SP|P09158 Spermidine synthase (EC
           2.5.1.16) (Putrescine aminopropyltransferase)
           {Escherichia coli}; contains Pfam profile PF01564:
           Spermine/spermidine synthase
          Length = 339

 Score = 27.5 bits (58), Expect = 9.0
 Identities = 14/33 (42%), Positives = 20/33 (60%), Gaps = 3/33 (9%)
 Frame = +1

Query: 562 KEIKWVHYNTCEEVFKECKSLPS---SFLETWG 651
           KE+    YNT ++VFK  K+  +   SF +TWG
Sbjct: 232 KEVFTSIYNTMKQVFKYVKAYTAHVPSFADTWG 264


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 14,183,325
Number of Sequences: 28952
Number of extensions: 278018
Number of successful extensions: 655
Number of sequences better than 10.0: 3
Number of HSP's better than 10.0 without gapping: 637
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 655
length of database: 12,070,560
effective HSP length: 79
effective length of database: 9,783,352
effective search space used: 1496852856
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).