SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= tesS0015
         (598 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At4g20890.1 68417.m03029 tubulin beta-9 chain (TUB9) nearly iden...   179   1e-45
At1g20010.1 68414.m02506 tubulin beta-5 chain (TUB5) nearly iden...   179   1e-45
At1g75780.1 68414.m08801 tubulin beta-1 chain (TUB1) nearly iden...   178   3e-45
At2g29550.1 68415.m03589 tubulin beta-7 chain (TUB7) identical t...   175   1e-44
At5g23860.1 68418.m02801 tubulin beta-8 chain (TUB8) (TUBB8) ide...   174   4e-44
At5g44340.1 68418.m05429 tubulin beta-4 chain (TUB4) nearly iden...   173   7e-44
At5g12250.1 68418.m01439 tubulin beta-6 chain (TUB6) nearly iden...   173   1e-43
At5g62700.1 68418.m07868 tubulin beta-2/beta-3 chain (TUB3) near...   171   3e-43
At5g62690.1 68418.m07867 tubulin beta-2/beta-3 chain (TUB2) near...   171   3e-43
At5g19780.1 68418.m02351 tubulin alpha-3/alpha-5 chain (TUA5) ne...    99   3e-21
At5g19770.1 68418.m02350 tubulin alpha-3/alpha-5 chain (TUA3) ne...    99   3e-21
At4g14960.2 68417.m02299 tubulin alpha-6 chain (TUA6) nearly ide...    98   4e-21
At4g14960.1 68417.m02298 tubulin alpha-6 chain (TUA6) nearly ide...    98   4e-21
At1g50010.1 68414.m05612 tubulin alpha-2/alpha-4 chain (TUA2) id...    98   4e-21
At1g04820.1 68414.m00478 tubulin alpha-2/alpha-4 chain (TUA4) ne...    98   4e-21
At1g64740.1 68414.m07340 tubulin alpha-1 chain (TUA1) nearly ide...    96   2e-20
At5g05620.1 68418.m00612 tubulin gamma-2 chain / gamma-2 tubulin...    71   8e-13
At3g61650.1 68416.m06909 tubulin gamma-1 chain / gamma-1 tubulin...    70   1e-12
At2g31580.1 68415.m03858 expressed protein   contains Pfam profi...    31   0.44 
At4g37190.1 68417.m05265 expressed protein                             30   1.0  
At3g24550.1 68416.m03083 protein kinase family protein contains ...    29   1.8  
At2g26850.1 68415.m03221 F-box family protein contains Pfam PF00...    29   1.8  
At3g10900.1 68416.m01312 (1-4)-beta-mannan endohydrolase, putati...    29   2.4  
At2g40820.1 68415.m05038 proline-rich family protein contains pr...    28   5.4  
At1g54970.1 68414.m06278 proline-rich family protein similar to ...    28   5.4  
At5g55500.1 68418.m06912 beta-(1,2)-xylosyltransferase (XYLT) id...    27   7.2  
At3g61360.1 68416.m06866 pentatricopeptide (PPR) repeat-containi...    27   7.2  
At1g53300.1 68414.m06041 thioredoxin family protein contains Pfa...    27   7.2  
At1g49490.1 68414.m05547 leucine-rich repeat family protein / ex...    27   7.2  
At5g07780.1 68418.m00890 formin homology 2 domain-containing pro...    27   9.5  
At3g15070.1 68416.m01906 zinc finger (C3HC4-type RING finger) fa...    27   9.5  

>At4g20890.1 68417.m03029 tubulin beta-9 chain (TUB9) nearly
           identical to SP|P29517 Tubulin beta-9 chain {Arabidopsis
           thaliana}
          Length = 444

 Score =  179 bits (436), Expect = 1e-45
 Identities = 79/87 (90%), Positives = 85/87 (97%)
 Frame = +2

Query: 257 INVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHY 436
           INVY+NEASGGKYVPRAV++DLEPGTMDS+RSGPFGQIFRPDNFVFGQSGAGNNWAKGHY
Sbjct: 47  INVYFNEASGGKYVPRAVLMDLEPGTMDSLRSGPFGQIFRPDNFVFGQSGAGNNWAKGHY 106

Query: 437 TEGAELVDSVLDVVRKEAEGCDCLRVF 517
           TEGAEL+DSVLDVVRKEAE CDCL+ F
Sbjct: 107 TEGAELIDSVLDVVRKEAENCDCLQGF 133



 Score = 81.8 bits (193), Expect = 3e-16
 Identities = 36/45 (80%), Positives = 38/45 (84%)
 Frame = +3

Query: 120 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDLQLE 254
           MREI+HIQ GQCGNQIGAKFWEVI  EHGID TG   GD+DLQLE
Sbjct: 1   MREILHIQGGQCGNQIGAKFWEVICGEHGIDQTGQSCGDTDLQLE 45


>At1g20010.1 68414.m02506 tubulin beta-5 chain (TUB5) nearly
           identical to SP|P29513 Tubulin beta-5 chain {Arabidopsis
           thaliana}
          Length = 449

 Score =  179 bits (436), Expect = 1e-45
 Identities = 78/87 (89%), Positives = 85/87 (97%)
 Frame = +2

Query: 257 INVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHY 436
           INVYYNEASGG+YVPRAV++DLEPGTMDS+RSGPFGQIFRPDNFVFGQSGAGNNWAKGHY
Sbjct: 48  INVYYNEASGGRYVPRAVLMDLEPGTMDSIRSGPFGQIFRPDNFVFGQSGAGNNWAKGHY 107

Query: 437 TEGAELVDSVLDVVRKEAEGCDCLRVF 517
           TEGAEL+D+VLDVVRKEAE CDCL+ F
Sbjct: 108 TEGAELIDAVLDVVRKEAENCDCLQGF 134



 Score = 85.4 bits (202), Expect = 3e-17
 Identities = 38/46 (82%), Positives = 42/46 (91%), Gaps = 1/46 (2%)
 Frame = +3

Query: 120 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGD-SDLQLE 254
           MREI+HIQ GQCGNQIG+KFWEVI DEHGID+TG YSGD +DLQLE
Sbjct: 1   MREILHIQGGQCGNQIGSKFWEVICDEHGIDSTGRYSGDTADLQLE 46


>At1g75780.1 68414.m08801 tubulin beta-1 chain (TUB1) nearly
           identical to SP|P12411 Tubulin beta-1 chain {Arabidopsis
           thaliana}
          Length = 447

 Score =  178 bits (433), Expect = 3e-45
 Identities = 77/87 (88%), Positives = 85/87 (97%)
 Frame = +2

Query: 257 INVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHY 436
           INVYYNEASGG+YVPRAV++DLEPGTMDS+RSGP+GQIFRPDNFVFGQSGAGNNWAKGHY
Sbjct: 48  INVYYNEASGGRYVPRAVLMDLEPGTMDSIRSGPYGQIFRPDNFVFGQSGAGNNWAKGHY 107

Query: 437 TEGAELVDSVLDVVRKEAEGCDCLRVF 517
           TEGAEL+D+VLDVVRKEAE CDCL+ F
Sbjct: 108 TEGAELIDAVLDVVRKEAENCDCLQGF 134



 Score = 83.8 bits (198), Expect = 8e-17
 Identities = 36/46 (78%), Positives = 41/46 (89%), Gaps = 1/46 (2%)
 Frame = +3

Query: 120 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDS-DLQLE 254
           MREI+H+Q GQCGNQIG+KFWEVI DEHG+D TG Y+GDS DLQLE
Sbjct: 1   MREILHVQGGQCGNQIGSKFWEVICDEHGVDPTGRYNGDSADLQLE 46


>At2g29550.1 68415.m03589 tubulin beta-7 chain (TUB7) identical to
           GB:M84704 SP|P29515 Tubulin beta-7 chain {Arabidopsis
           thaliana}
          Length = 449

 Score =  175 bits (427), Expect = 1e-44
 Identities = 77/87 (88%), Positives = 84/87 (96%)
 Frame = +2

Query: 257 INVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHY 436
           +NVYYNEAS G+YVPRAV++DLEPGTMDSVRSGP+GQIFRPDNFVFGQSGAGNNWAKGHY
Sbjct: 47  VNVYYNEASCGRYVPRAVLMDLEPGTMDSVRSGPYGQIFRPDNFVFGQSGAGNNWAKGHY 106

Query: 437 TEGAELVDSVLDVVRKEAEGCDCLRVF 517
           TEGAEL+DSVLDVVRKEAE CDCL+ F
Sbjct: 107 TEGAELIDSVLDVVRKEAENCDCLQGF 133



 Score = 82.6 bits (195), Expect = 2e-16
 Identities = 35/45 (77%), Positives = 40/45 (88%)
 Frame = +3

Query: 120 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDLQLE 254
           MREI+HIQ GQCGNQIG+KFWEV++ EHGID TG Y GDS+LQLE
Sbjct: 1   MREILHIQGGQCGNQIGSKFWEVVNLEHGIDQTGRYVGDSELQLE 45


>At5g23860.1 68418.m02801 tubulin beta-8 chain (TUB8) (TUBB8)
           identical to SP|P29516 Tubulin beta-8 chain {Arabidopsis
           thaliana}; supporting cDNA gi|15451225|gb|AY054693.1|
          Length = 449

 Score =  174 bits (423), Expect = 4e-44
 Identities = 76/87 (87%), Positives = 84/87 (96%)
 Frame = +2

Query: 257 INVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHY 436
           +NVYYNEAS G++VPRAV++DLEPGTMDSVRSGP+GQIFRPDNFVFGQSGAGNNWAKGHY
Sbjct: 47  VNVYYNEASCGRFVPRAVLMDLEPGTMDSVRSGPYGQIFRPDNFVFGQSGAGNNWAKGHY 106

Query: 437 TEGAELVDSVLDVVRKEAEGCDCLRVF 517
           TEGAEL+DSVLDVVRKEAE CDCL+ F
Sbjct: 107 TEGAELIDSVLDVVRKEAENCDCLQGF 133



 Score = 84.2 bits (199), Expect = 6e-17
 Identities = 35/45 (77%), Positives = 40/45 (88%)
 Frame = +3

Query: 120 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDLQLE 254
           MREI+HIQ GQCGNQIGAKFWEV+  EHGID+TG Y G++DLQLE
Sbjct: 1   MREILHIQGGQCGNQIGAKFWEVVCAEHGIDSTGRYQGENDLQLE 45


>At5g44340.1 68418.m05429 tubulin beta-4 chain (TUB4) nearly
           identical to SP|P24636 Tubulin beta-4 chain {Arabidopsis
           thaliana}
          Length = 444

 Score =  173 bits (421), Expect = 7e-44
 Identities = 77/87 (88%), Positives = 84/87 (96%)
 Frame = +2

Query: 257 INVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHY 436
           I+VY+NEASGGKYVPRAV++DLEPGTMDS+RSGPFGQIFRPDNFVFGQSGAGNNWAKGHY
Sbjct: 47  IDVYFNEASGGKYVPRAVLMDLEPGTMDSLRSGPFGQIFRPDNFVFGQSGAGNNWAKGHY 106

Query: 437 TEGAELVDSVLDVVRKEAEGCDCLRVF 517
           TEGAEL+DSVLDVVRKEAE  DCL+ F
Sbjct: 107 TEGAELIDSVLDVVRKEAENSDCLQGF 133



 Score = 85.8 bits (203), Expect = 2e-17
 Identities = 38/45 (84%), Positives = 39/45 (86%)
 Frame = +3

Query: 120 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDLQLE 254
           MREI+HIQ GQCGNQIGAKFWEVI DEHGID TG Y GDS LQLE
Sbjct: 1   MREILHIQGGQCGNQIGAKFWEVICDEHGIDHTGQYVGDSPLQLE 45


>At5g12250.1 68418.m01439 tubulin beta-6 chain (TUB6) nearly
           identical to SP|P29514 Tubulin beta-6 chain {Arabidopsis
           thaliana}
          Length = 449

 Score =  173 bits (420), Expect = 1e-43
 Identities = 74/87 (85%), Positives = 84/87 (96%)
 Frame = +2

Query: 257 INVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHY 436
           +NVYYNEAS G+YVPRA+++DLEPGTMDSVR+GP+GQIFRPDNFVFGQSGAGNNWAKGHY
Sbjct: 47  VNVYYNEASCGRYVPRAILMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHY 106

Query: 437 TEGAELVDSVLDVVRKEAEGCDCLRVF 517
           TEGAEL+D+VLDVVRKEAE CDCL+ F
Sbjct: 107 TEGAELIDAVLDVVRKEAENCDCLQGF 133



 Score = 85.4 bits (202), Expect = 3e-17
 Identities = 36/45 (80%), Positives = 40/45 (88%)
 Frame = +3

Query: 120 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDLQLE 254
           MREI+HIQ GQCGNQIG+KFWEV+ DEHGID TG Y G+SDLQLE
Sbjct: 1   MREILHIQGGQCGNQIGSKFWEVVCDEHGIDPTGRYVGNSDLQLE 45


>At5g62700.1 68418.m07868 tubulin beta-2/beta-3 chain (TUB3) nearly
           identical to SP|P29512 Tubulin beta-2/beta-3 chain
           {Arabidopsis thaliana}
          Length = 450

 Score =  171 bits (416), Expect = 3e-43
 Identities = 75/87 (86%), Positives = 83/87 (95%)
 Frame = +2

Query: 257 INVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHY 436
           INVYYNEAS G++VPRAV++DLEPGTMDS+RSGP+GQ FRPDNFVFGQSGAGNNWAKGHY
Sbjct: 47  INVYYNEASCGRFVPRAVLMDLEPGTMDSLRSGPYGQTFRPDNFVFGQSGAGNNWAKGHY 106

Query: 437 TEGAELVDSVLDVVRKEAEGCDCLRVF 517
           TEGAEL+DSVLDVVRKEAE CDCL+ F
Sbjct: 107 TEGAELIDSVLDVVRKEAENCDCLQGF 133



 Score = 86.6 bits (205), Expect = 1e-17
 Identities = 37/45 (82%), Positives = 40/45 (88%)
 Frame = +3

Query: 120 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDLQLE 254
           MREI+HIQ GQCGNQIGAKFWEV+  EHGID TG Y+GDSDLQLE
Sbjct: 1   MREILHIQGGQCGNQIGAKFWEVVCAEHGIDPTGRYTGDSDLQLE 45


>At5g62690.1 68418.m07867 tubulin beta-2/beta-3 chain (TUB2) nearly
           identical to SP|P29512 Tubulin beta-2/beta-3 chain
           {Arabidopsis thaliana}
          Length = 450

 Score =  171 bits (416), Expect = 3e-43
 Identities = 75/87 (86%), Positives = 83/87 (95%)
 Frame = +2

Query: 257 INVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHY 436
           INVYYNEAS G++VPRAV++DLEPGTMDS+RSGP+GQ FRPDNFVFGQSGAGNNWAKGHY
Sbjct: 47  INVYYNEASCGRFVPRAVLMDLEPGTMDSLRSGPYGQTFRPDNFVFGQSGAGNNWAKGHY 106

Query: 437 TEGAELVDSVLDVVRKEAEGCDCLRVF 517
           TEGAEL+DSVLDVVRKEAE CDCL+ F
Sbjct: 107 TEGAELIDSVLDVVRKEAENCDCLQGF 133



 Score = 86.6 bits (205), Expect = 1e-17
 Identities = 37/45 (82%), Positives = 40/45 (88%)
 Frame = +3

Query: 120 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDLQLE 254
           MREI+HIQ GQCGNQIGAKFWEV+  EHGID TG Y+GDSDLQLE
Sbjct: 1   MREILHIQGGQCGNQIGAKFWEVVCAEHGIDPTGRYTGDSDLQLE 45


>At5g19780.1 68418.m02351 tubulin alpha-3/alpha-5 chain (TUA5)
           nearly identical to SP|P20363 Tubulin alpha-3/alpha-5
           chain {Arabidopsis thaliana}
          Length = 450

 Score = 98.7 bits (235), Expect = 3e-21
 Identities = 43/88 (48%), Positives = 60/88 (68%)
 Frame = +2

Query: 254 SINVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH 433
           + N +++E   GK+VPRAV VDLEP  +D VR+G + Q+F P+  + G+  A NN+A+GH
Sbjct: 48  AFNTFFSETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGH 107

Query: 434 YTEGAELVDSVLDVVRKEAEGCDCLRVF 517
           YT G E+VD  LD VRK A+ C  L+ F
Sbjct: 108 YTVGKEIVDLCLDRVRKLADNCTGLQGF 135



 Score = 40.3 bits (90), Expect = 0.001
 Identities = 18/40 (45%), Positives = 22/40 (55%)
 Frame = +3

Query: 120 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDS 239
           MREI+ I  GQ G Q+G   WE+   EHGI   G    D+
Sbjct: 1   MREIISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDT 40


>At5g19770.1 68418.m02350 tubulin alpha-3/alpha-5 chain (TUA3)
           nearly identical to SP|P20363 Tubulin alpha-3/alpha-5
           chain {Arabidopsis thaliana}
          Length = 450

 Score = 98.7 bits (235), Expect = 3e-21
 Identities = 43/88 (48%), Positives = 60/88 (68%)
 Frame = +2

Query: 254 SINVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH 433
           + N +++E   GK+VPRAV VDLEP  +D VR+G + Q+F P+  + G+  A NN+A+GH
Sbjct: 48  AFNTFFSETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGH 107

Query: 434 YTEGAELVDSVLDVVRKEAEGCDCLRVF 517
           YT G E+VD  LD VRK A+ C  L+ F
Sbjct: 108 YTVGKEIVDLCLDRVRKLADNCTGLQGF 135



 Score = 40.3 bits (90), Expect = 0.001
 Identities = 18/40 (45%), Positives = 22/40 (55%)
 Frame = +3

Query: 120 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDS 239
           MREI+ I  GQ G Q+G   WE+   EHGI   G    D+
Sbjct: 1   MREIISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDT 40


>At4g14960.2 68417.m02299 tubulin alpha-6 chain (TUA6) nearly
           identical to SP|P29511 Tubulin alpha-6 chain
           {Arabidopsis thaliana}
          Length = 450

 Score = 97.9 bits (233), Expect = 4e-21
 Identities = 42/88 (47%), Positives = 60/88 (68%)
 Frame = +2

Query: 254 SINVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH 433
           + N +++E   GK+VPRAV VDLEP  +D VR+G + Q+F P+  + G+  A NN+A+GH
Sbjct: 48  AFNTFFSETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGH 107

Query: 434 YTEGAELVDSVLDVVRKEAEGCDCLRVF 517
           YT G E+VD  LD +RK A+ C  L+ F
Sbjct: 108 YTIGKEIVDLCLDRIRKLADNCTGLQGF 135



 Score = 39.9 bits (89), Expect = 0.001
 Identities = 18/39 (46%), Positives = 21/39 (53%)
 Frame = +3

Query: 120 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGD 236
           MRE + I  GQ G Q+G   WE+   EHGI   G   GD
Sbjct: 1   MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGD 39


>At4g14960.1 68417.m02298 tubulin alpha-6 chain (TUA6) nearly
           identical to SP|P29511 Tubulin alpha-6 chain
           {Arabidopsis thaliana}
          Length = 427

 Score = 97.9 bits (233), Expect = 4e-21
 Identities = 42/88 (47%), Positives = 60/88 (68%)
 Frame = +2

Query: 254 SINVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH 433
           + N +++E   GK+VPRAV VDLEP  +D VR+G + Q+F P+  + G+  A NN+A+GH
Sbjct: 48  AFNTFFSETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGH 107

Query: 434 YTEGAELVDSVLDVVRKEAEGCDCLRVF 517
           YT G E+VD  LD +RK A+ C  L+ F
Sbjct: 108 YTIGKEIVDLCLDRIRKLADNCTGLQGF 135



 Score = 39.9 bits (89), Expect = 0.001
 Identities = 18/39 (46%), Positives = 21/39 (53%)
 Frame = +3

Query: 120 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGD 236
           MRE + I  GQ G Q+G   WE+   EHGI   G   GD
Sbjct: 1   MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGD 39


>At1g50010.1 68414.m05612 tubulin alpha-2/alpha-4 chain (TUA2)
           identical to tubulin alpha-2/alpha-4 chain SP|P29510
           GB:P29510 from [Arabidopsis thaliana]
          Length = 450

 Score = 97.9 bits (233), Expect = 4e-21
 Identities = 42/88 (47%), Positives = 60/88 (68%)
 Frame = +2

Query: 254 SINVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH 433
           + N +++E   GK+VPRAV VDLEP  +D VR+G + Q+F P+  + G+  A NN+A+GH
Sbjct: 48  AFNTFFSETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGH 107

Query: 434 YTEGAELVDSVLDVVRKEAEGCDCLRVF 517
           YT G E+VD  LD +RK A+ C  L+ F
Sbjct: 108 YTIGKEIVDLCLDRIRKLADNCTGLQGF 135



 Score = 37.5 bits (83), Expect = 0.007
 Identities = 17/39 (43%), Positives = 20/39 (51%)
 Frame = +3

Query: 120 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGD 236
           MRE + I  GQ G Q+G   WE+   EHGI   G    D
Sbjct: 1   MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSD 39


>At1g04820.1 68414.m00478 tubulin alpha-2/alpha-4 chain (TUA4)
           nearly identical to SP:P29510 Tubulin alpha-2/alpha-4
           chain from [Arabidopsis thaliana]
          Length = 450

 Score = 97.9 bits (233), Expect = 4e-21
 Identities = 42/88 (47%), Positives = 60/88 (68%)
 Frame = +2

Query: 254 SINVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH 433
           + N +++E   GK+VPRAV VDLEP  +D VR+G + Q+F P+  + G+  A NN+A+GH
Sbjct: 48  AFNTFFSETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGH 107

Query: 434 YTEGAELVDSVLDVVRKEAEGCDCLRVF 517
           YT G E+VD  LD +RK A+ C  L+ F
Sbjct: 108 YTIGKEIVDLCLDRIRKLADNCTGLQGF 135



 Score = 37.5 bits (83), Expect = 0.007
 Identities = 17/39 (43%), Positives = 20/39 (51%)
 Frame = +3

Query: 120 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGD 236
           MRE + I  GQ G Q+G   WE+   EHGI   G    D
Sbjct: 1   MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSD 39


>At1g64740.1 68414.m07340 tubulin alpha-1 chain (TUA1) nearly
           identical to SP|P11139 Tubulin alpha-1 chain
           {Arabidopsis thaliana}
          Length = 450

 Score = 95.9 bits (228), Expect = 2e-20
 Identities = 40/88 (45%), Positives = 62/88 (70%)
 Frame = +2

Query: 254 SINVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH 433
           + N +++E S G++VPRAV +DLEP  +D VR+G + Q+F P+  + G+  A NN+A+GH
Sbjct: 48  AFNTFFSETSSGQHVPRAVFLDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGH 107

Query: 434 YTEGAELVDSVLDVVRKEAEGCDCLRVF 517
           YT G E+VD+ L+ +RK A+ C  L+ F
Sbjct: 108 YTVGREIVDTCLERLRKLADNCTGLQGF 135



 Score = 41.9 bits (94), Expect = 3e-04
 Identities = 19/40 (47%), Positives = 22/40 (55%)
 Frame = +3

Query: 120 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDS 239
           MREI+ I  GQ G Q+G   WE+   EHGI   G    DS
Sbjct: 1   MREIISIHIGQAGIQVGNSCWELYCLEHGIQPDGTMPSDS 40


>At5g05620.1 68418.m00612 tubulin gamma-2 chain / gamma-2 tubulin
           (TUBG2) identical to  SP|P38558 Tubulin gamma-2 chain
           (Gamma-2 tubulin) {Arabidopsis thaliana}
          Length = 474

 Score = 70.5 bits (165), Expect = 8e-13
 Identities = 29/88 (32%), Positives = 55/88 (62%), Gaps = 2/88 (2%)
 Frame = +2

Query: 260 NVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQ--SGAGNNWAKGH 433
           +V++ +A    Y+PRA+++DLEP  ++ +++G +  ++  +N        GAGNNWA G 
Sbjct: 49  DVFFYQADDQHYIPRALLIDLEPRVINGIQNGEYRNLYNHENIFLSDHGGGAGNNWASG- 107

Query: 434 YTEGAELVDSVLDVVRKEAEGCDCLRVF 517
           Y +G  + + ++D++ +EA+G D L  F
Sbjct: 108 YHQGKGVEEEIMDMIDREADGSDSLEGF 135



 Score = 48.0 bits (109), Expect = 5e-06
 Identities = 19/33 (57%), Positives = 24/33 (72%)
 Frame = +3

Query: 123 REIVHIQAGQCGNQIGAKFWEVISDEHGIDATG 221
           REI+ +Q GQCGNQIG +FW+ +  EHGI   G
Sbjct: 3   REIITLQVGQCGNQIGMEFWKQLCLEHGISKDG 35


>At3g61650.1 68416.m06909 tubulin gamma-1 chain / gamma-1 tubulin
           (TUBG1) identical to SP|P38557 Tubulin gamma-1 chain
           (Gamma-1 tubulin) {Arabidopsis thaliana}
          Length = 474

 Score = 70.1 bits (164), Expect = 1e-12
 Identities = 29/88 (32%), Positives = 55/88 (62%), Gaps = 2/88 (2%)
 Frame = +2

Query: 260 NVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQ--SGAGNNWAKGH 433
           +V++ +A    Y+PRA+++DLEP  ++ +++G +  ++  +N        GAGNNWA G 
Sbjct: 49  DVFFYQADDQHYIPRALLIDLEPRVINGIQNGDYRNLYNHENIFVADHGGGAGNNWASG- 107

Query: 434 YTEGAELVDSVLDVVRKEAEGCDCLRVF 517
           Y +G  + + ++D++ +EA+G D L  F
Sbjct: 108 YHQGKGVEEEIMDMIDREADGSDSLEGF 135



 Score = 48.0 bits (109), Expect = 5e-06
 Identities = 19/33 (57%), Positives = 24/33 (72%)
 Frame = +3

Query: 123 REIVHIQAGQCGNQIGAKFWEVISDEHGIDATG 221
           REI+ +Q GQCGNQIG +FW+ +  EHGI   G
Sbjct: 3   REIITLQVGQCGNQIGMEFWKQLCLEHGISKDG 35


>At2g31580.1 68415.m03858 expressed protein   contains Pfam profile:
           PF04446 family of unknown function (DUF549)
          Length = 567

 Score = 31.5 bits (68), Expect = 0.44
 Identities = 14/22 (63%), Positives = 19/22 (86%)
 Frame = +2

Query: 452 LVDSVLDVVRKEAEGCDCLRVF 517
           +++SV  VVRKEAE C+CL+VF
Sbjct: 1   MINSV-GVVRKEAENCNCLQVF 21


>At4g37190.1 68417.m05265 expressed protein
          Length = 562

 Score = 30.3 bits (65), Expect = 1.0
 Identities = 12/21 (57%), Positives = 15/21 (71%)
 Frame = +3

Query: 120 MREIVHIQAGQCGNQIGAKFW 182
           MREIV IQ G+  N +G+ FW
Sbjct: 1   MREIVTIQVGEFANFVGSHFW 21


>At3g24550.1 68416.m03083 protein kinase family protein contains
           Pfam domain PF00069: Protein kinase domain
          Length = 652

 Score = 29.5 bits (63), Expect = 1.8
 Identities = 22/64 (34%), Positives = 28/64 (43%), Gaps = 4/64 (6%)
 Frame = -3

Query: 470 PVPNQPVQPPLCNXLSP-SYSPPQTVRRRSCPVGRFAQ---TARNGRSPWFQAQGPPSQL 303
           P P+ P+ P L     P S +PP      S P+        T  N RSP    QGPP+  
Sbjct: 54  PPPSSPLPPSLPPPSPPGSLTPPLPQPSPSAPITPSPPSPTTPSNPRSPPSPNQGPPNTP 113

Query: 302 AGRT 291
           +G T
Sbjct: 114 SGST 117


>At2g26850.1 68415.m03221 F-box family protein contains Pfam
           PF00646: F-box domain; similar to SKP1 interacting
           partner 2 (SKIP2) TIGR_Ath1:At5g67250
          Length = 371

 Score = 29.5 bits (63), Expect = 1.8
 Identities = 12/30 (40%), Positives = 18/30 (60%)
 Frame = -3

Query: 182 PELCSDLIPALTRLDVDDFPHDCTKNLEPP 93
           P+L S ++  ++ LD+ D P DC   L PP
Sbjct: 50  PDLASPVLGKMSILDLPDLPLDCILELLPP 79


>At3g10900.1 68416.m01312 (1-4)-beta-mannan endohydrolase, putative
           similar to (1-4)-beta-mannan endohydrolase [Coffea
           arabica] GI:10178872, (1-4)-beta-mannan endohydrolase
           GB:AAB87859 [Lycopersicon esculentum]; contains Pfam
           profile PF00150: Cellulase (glycosyl hydrolase family 5)
          Length = 408

 Score = 29.1 bits (62), Expect = 2.4
 Identities = 16/49 (32%), Positives = 26/49 (53%)
 Frame = +3

Query: 126 EIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDLQLEASMSTI 272
           +I++  A + G+  GA FWEVIS     +    ++G S + L    ST+
Sbjct: 346 DIIYASAQKGGSAAGALFWEVIS-----EGMSNFAGPSSIILSDKSSTV 389


>At2g40820.1 68415.m05038 proline-rich family protein contains
           proline rich extensin domains, INTERPRO:IPR002965
          Length = 903

 Score = 27.9 bits (59), Expect = 5.4
 Identities = 18/58 (31%), Positives = 27/58 (46%)
 Frame = -3

Query: 473 HPVPNQPVQPPLCNXLSPSYSPPQTVRRRSCPVGRFAQTARNGRSPWFQAQGPPSQLA 300
           +P P QP  PP+ +   P+Y  P++V   S P      T    + P++    PP Q A
Sbjct: 760 YPPPMQPPPPPMNSGYMPTYI-PKSVNDSSMPNPPMNNTNPQMQQPYYP---PPMQPA 813


>At1g54970.1 68414.m06278 proline-rich family protein similar to
           proline-rich protein GI:170048 from [Glycine max]
          Length = 335

 Score = 27.9 bits (59), Expect = 5.4
 Identities = 12/22 (54%), Positives = 13/22 (59%)
 Frame = -3

Query: 470 PVPNQPVQPPLCNXLSPSYSPP 405
           PV  +P  PP     SPSYSPP
Sbjct: 169 PVYTKPTLPPPVYKKSPSYSPP 190


>At5g55500.1 68418.m06912 beta-(1,2)-xylosyltransferase (XYLT)
           identical to SP|Q9LDH0
          Length = 534

 Score = 27.5 bits (58), Expect = 7.2
 Identities = 21/69 (30%), Positives = 34/69 (49%), Gaps = 6/69 (8%)
 Frame = -3

Query: 281 KLRYSRH*CFKLQVGVAAVSTRGVNAVLVRDYFPE------LCSDLIPALTRLDVDDFPH 120
           +L + RH  F    G +AVS R VN  ++ +Y  E         DL+ ++  +D +DF  
Sbjct: 171 RLGFKRHRRFGGGEGGSAVSRRLVNDEMLNEYMQEGGIDRHTMRDLVASIRAVDTNDFV- 229

Query: 119 DCTKNLEPP 93
            C + +E P
Sbjct: 230 -CEEWVEEP 237


>At3g61360.1 68416.m06866 pentatricopeptide (PPR) repeat-containing
           protein contains Pfam profile PF01535: PPR repeat
          Length = 498

 Score = 27.5 bits (58), Expect = 7.2
 Identities = 16/43 (37%), Positives = 20/43 (46%)
 Frame = -3

Query: 473 HPVPNQPVQPPLCNXLSPSYSPPQTVRRRSCPVGRFAQTARNG 345
           HP PN P+QP L   +  S   P+ V   S  +GR      NG
Sbjct: 44  HPFPNHPIQPILAKHIPLSSLSPEFV---SEVLGRLFAAHSNG 83


>At1g53300.1 68414.m06041 thioredoxin family protein contains Pfam
           profiles PF00085: Thioredoxin, PF00515: TPR Domain;
           similar to tetratricopeptide repeat protein 2
           (GI:7248701) [Drosophila melanogaster]; similar to DnaJ
           homolog subfamily C member 7 (Tetratricopeptide repeat
           protein 2) (TPR repeat protein 2) (Swiss-Prot:Q99615)
           [Homo sapiens]
          Length = 699

 Score = 27.5 bits (58), Expect = 7.2
 Identities = 15/40 (37%), Positives = 18/40 (45%), Gaps = 1/40 (2%)
 Frame = -2

Query: 411 PAPDCPKTKLSGRKICPNGPERTESMVPG-SRSTITARGT 295
           PAP  P   L    ICP+G  +   M    SRS +   GT
Sbjct: 129 PAPTSPANVLPTGNICPSGKIQITGMTQSRSRSDVLGSGT 168


>At1g49490.1 68414.m05547 leucine-rich repeat family protein /
           extensin family protein contains similarity to disease
           resistance protein GI:3894383 from [Lycopersicon
           esculentum]; contains leucine-rich repeats,
           Pfam:PF00560; contains proline rich extensin domains,
           INTERPRO:IPR002965
          Length = 847

 Score = 27.5 bits (58), Expect = 7.2
 Identities = 11/33 (33%), Positives = 17/33 (51%)
 Frame = -3

Query: 470 PVPNQPVQPPLCNXLSPSYSPPQTVRRRSCPVG 372
           P P+    PP+ +   P++SPP T      P+G
Sbjct: 619 PPPSHSPPPPVYSPPPPTFSPPPTHNTNQPPMG 651


>At5g07780.1 68418.m00890 formin homology 2 domain-containing
           protein / FH2 domain-containing protein contains formin
           homology 2 domain, Pfam:PF02181
          Length = 464

 Score = 27.1 bits (57), Expect = 9.5
 Identities = 13/31 (41%), Positives = 17/31 (54%)
 Frame = -3

Query: 470 PVPNQPVQPPLCNXLSPSYSPPQTVRRRSCP 378
           P+P  P  PPL    +P   PP  +RRR+ P
Sbjct: 28  PLPPPP-PPPLMRRRAPPPPPPPLMRRRAPP 57


>At3g15070.1 68416.m01906 zinc finger (C3HC4-type RING finger)
           family protein similar to C-terminal zinc-finger
           [Glycine max] GI:558543; contains Pfam profile: PF00097
           zinc finger, C3HC4 type (RING finger)
          Length = 486

 Score = 27.1 bits (57), Expect = 9.5
 Identities = 17/50 (34%), Positives = 23/50 (46%)
 Frame = -3

Query: 452 VQPPLCNXLSPSYSPPQTVRRRSCPVGRFAQTARNGRSPWFQAQGPPSQL 303
           +Q P  N  S  Y PPQ   + +  +G    TA N   P+   + PPS L
Sbjct: 50  LQEPYDNN-SMFYGPPQYHHQHASNLGSGMSTAPNFYVPYVNYEAPPSFL 98


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 13,691,265
Number of Sequences: 28952
Number of extensions: 302275
Number of successful extensions: 1050
Number of sequences better than 10.0: 31
Number of HSP's better than 10.0 without gapping: 894
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1037
length of database: 12,070,560
effective HSP length: 77
effective length of database: 9,841,256
effective search space used: 1190791976
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).