SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= tesS0013
         (698 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At1g67430.1 68414.m07675 60S ribosomal protein L17 (RPL17B) simi...    55   5e-08
At1g27400.1 68414.m03340 60S ribosomal protein L17 (RPL17A) simi...    53   2e-07
At4g10350.1 68417.m01700 no apical meristem (NAM) family protein...    35   0.060
At2g32140.1 68415.m03928 disease resistance protein (TIR class),...    32   0.42 
At5g26130.1 68418.m03108 pathogenesis-related protein, putative ...    31   0.56 
At5g63540.1 68418.m07975 expressed protein  ; expression support...    31   0.73 
At1g31370.1 68414.m03839 expressed protein ; expression supporte...    29   2.2  
At3g62110.1 68416.m06978 glycoside hydrolase family 28 protein /...    29   3.9  
At4g29730.1 68417.m04233 WD-40 repeat family protein contains 5 ...    28   5.2  
At5g08010.1 68418.m00932 expressed protein condensin subunit SMC...    28   6.8  
At4g16390.1 68417.m02481 chloroplastic RNA-binding protein P67, ...    28   6.8  
At4g03430.1 68417.m00470 pre-mRNA splicing factor-related simila...    28   6.8  

>At1g67430.1 68414.m07675 60S ribosomal protein L17 (RPL17B) similar
           to ribosomal protein GI:19101 from [Hordeum vulgare]
          Length = 175

 Score = 54.8 bits (126), Expect = 5e-08
 Identities = 25/32 (78%), Positives = 27/32 (84%)
 Frame = +2

Query: 509 NPAKSCKARGSNLRVHFKNXYETAMAIRKMPL 604
           N  KSCKARGS+LRVHFKN  ETA AIRK+PL
Sbjct: 10  NQTKSCKARGSDLRVHFKNTRETAHAIRKLPL 41



 Score = 29.1 bits (62), Expect = 3.0
 Identities = 14/25 (56%), Positives = 18/25 (72%)
 Frame = +1

Query: 619 RYLKNVIDKKECIPFRRFXXRALGR 693
           RYL++VI  K+ IPF RF  R +GR
Sbjct: 46  RYLEDVIAHKQAIPFTRF-CRGVGR 69


>At1g27400.1 68414.m03340 60S ribosomal protein L17 (RPL17A) similar
           to GB:P51413 from [Arabidopsis thaliana]; similar to
           ESTs gb|L33542 and gb|AA660016
          Length = 176

 Score = 52.8 bits (121), Expect = 2e-07
 Identities = 24/32 (75%), Positives = 27/32 (84%)
 Frame = +2

Query: 509 NPAKSCKARGSNLRVHFKNXYETAMAIRKMPL 604
           N  KSCKARG++LRVHFKN  ETA AIRK+PL
Sbjct: 10  NITKSCKARGADLRVHFKNTRETAHAIRKLPL 41



 Score = 29.1 bits (62), Expect = 3.0
 Identities = 14/25 (56%), Positives = 18/25 (72%)
 Frame = +1

Query: 619 RYLKNVIDKKECIPFRRFXXRALGR 693
           RYL++VI  K+ IPF RF  R +GR
Sbjct: 46  RYLEDVIAHKQAIPFTRF-CRGVGR 69


>At4g10350.1 68417.m01700 no apical meristem (NAM) family protein
           contains Pfam PF02365: No apical meristem (NAM) domain;
           nap gene, Arabidopsis thaliana, gb:AJ222713
          Length = 341

 Score = 34.7 bits (76), Expect = 0.060
 Identities = 15/44 (34%), Positives = 24/44 (54%)
 Frame = -2

Query: 301 GASLGNGDSVTSNAHRVLIWVWRLTDHLTTASNGSDSSSRGTEY 170
           G  +G  ++V S+ H+  +  W + D L T   G++ SSRG  Y
Sbjct: 265 GLDVGTCETVASHNHQQGLGEWAMMDRLVTCHMGNEDSSRGITY 308


>At2g32140.1 68415.m03928 disease resistance protein (TIR class),
           putative domain signature TIR exists, suggestive of a
           disease resistance protein.
          Length = 371

 Score = 31.9 bits (69), Expect = 0.42
 Identities = 40/143 (27%), Positives = 58/143 (40%), Gaps = 4/143 (2%)
 Frame = -2

Query: 511 VSGSRFLISVYLTRKTK-NTVRTASYNIKRPVADI-SQHPNHDSEQPP--ELLKTAVPRR 344
           VS  +    +Y T +   +T+R  S N    V    SQ PN D E      LLK  V   
Sbjct: 224 VSERKLTTDMYDTPEVSTSTMRKVSSNNGVGVGTFKSQKPNFDDEDDDGDSLLKALV--- 280

Query: 343 GAKLNARSTSILVRGASLGNGDSVTSNAHRVLIWVWRLTDHLTTASNGSDSSSRGTEYST 164
            AKL A +TSI+   A L    S    A   ++   +    L  +SNG    S     S+
Sbjct: 281 -AKLVASTTSIVAAYAELQRAHSDAIQAAETVVVDVKTLSELIRSSNGGGGGSGSGSGSS 339

Query: 163 TCRTARRAYSKARMACDTGGKAS 95
                RR+  + ++  +  G +S
Sbjct: 340 LENQPRRSKVRKQVWAEVLGISS 362


>At5g26130.1 68418.m03108 pathogenesis-related protein, putative
           similar to PR-1a protein [Nicotiana tabacum] GI:19944;
           contains Pfam profile PF00188: SCP-like extracellular
           protein
          Length = 164

 Score = 31.5 bits (68), Expect = 0.56
 Identities = 23/85 (27%), Positives = 35/85 (41%)
 Frame = -2

Query: 358 AVPRRGAKLNARSTSILVRGASLGNGDSVTSNAHRVLIWVWRLTDHLTTASNGSDSSSRG 179
           A  R+G      S S  + G +L       S A  V +WV   +D++  ++  SD    G
Sbjct: 62  AQQRKGDCSLTHSNSNGLYGENLAWSGGALSGAEAVKLWVNEKSDYIYASNTCSDGKQCG 121

Query: 178 TEYSTTCRTARRAYSKARMACDTGG 104
                  RT+      A++ CD GG
Sbjct: 122 HYTQVVWRTSEWV-GCAKVKCDNGG 145


>At5g63540.1 68418.m07975 expressed protein  ; expression supported
           by MPSS
          Length = 602

 Score = 31.1 bits (67), Expect = 0.73
 Identities = 31/108 (28%), Positives = 46/108 (42%)
 Frame = -2

Query: 490 ISVYLTRKTKNTVRTASYNIKRPVADISQHPNHDSEQPPELLKTAVPRRGAKLNARSTSI 311
           +   ++R     + TAS + +R  +DI    + +  +      T     GA   ARS + 
Sbjct: 318 VGATVSRVEHMQIDTASAHGERTFSDIHS-TSSNIHRAASTAGTGTSCSGACSGARSFAN 376

Query: 310 LVRGASLGNGDSVTSNAHRVLIWVWRLTDHLTTASNGSDSSSRGTEYS 167
            V G SL    +VTS    + I   R+ D  TT   GSDS     E+S
Sbjct: 377 NVGGNSLDQTSNVTSFVEEMHIDTGRVRD-TTTHIYGSDSGGVAAEFS 423


>At1g31370.1 68414.m03839 expressed protein ; expression supported
           by MPSS
          Length = 193

 Score = 29.5 bits (63), Expect = 2.2
 Identities = 16/38 (42%), Positives = 21/38 (55%)
 Frame = -3

Query: 462 KTPFEQRVTILSGQSPTFPNIRTTTANSLQSS*RPRCH 349
           K+ FE+   I S   P  P++RTT+ NSL S     CH
Sbjct: 126 KSLFEKHPDIASKFRPKNPHLRTTSLNSLLSLTEILCH 163


>At3g62110.1 68416.m06978 glycoside hydrolase family 28 protein /
           polygalacturonase (pectinase) family protein weak
           similarity to polygalacturonase [Lycopersicon
           esculentum] GI:4325090; contains PF00295: Glycosyl
           hydrolases family 28
          Length = 471

 Score = 28.7 bits (61), Expect = 3.9
 Identities = 17/58 (29%), Positives = 26/58 (44%)
 Frame = -2

Query: 295 SLGNGDSVTSNAHRVLIWVWRLTDHLTTASNGSDSSSRGTEYSTTCRTARRAYSKARM 122
           S G G  +    HR LI+   LTD + T  NG+    +GT +    R     Y++  +
Sbjct: 125 SYGRGRELPGRRHRSLIYGQNLTDVVITGENGT-IDGQGTVWWDWFRNGELNYTRPHL 181


>At4g29730.1 68417.m04233 WD-40 repeat family protein contains 5
           WD-40 repeats (PF0400);  similar to WD-40 repeat protein
           MSI4 (SP:O22607) [Arabidopsis thaliana]
          Length = 496

 Score = 28.3 bits (60), Expect = 5.2
 Identities = 12/27 (44%), Positives = 17/27 (62%)
 Frame = -2

Query: 241 VWRLTDHLTTASNGSDSSSRGTEYSTT 161
           +W + DH+T A  GSDS S G+ +  T
Sbjct: 235 LWNIQDHITMA--GSDSKSPGSSFKQT 259


>At5g08010.1 68418.m00932 expressed protein condensin subunit SMC4,
           Drosophila melanogaster, EMBL:AF186472
          Length = 566

 Score = 27.9 bits (59), Expect = 6.8
 Identities = 12/27 (44%), Positives = 17/27 (62%)
 Frame = +2

Query: 35  SIPKFHSSLQDLKQPSLQEPRCLATRV 115
           ++ K  SS +DL    L+ PRCLA+ V
Sbjct: 21  NVSKGKSSSEDLTNVKLESPRCLASNV 47


>At4g16390.1 68417.m02481 chloroplastic RNA-binding protein P67,
           putative nearly identical to 67kD chloroplastic
           RNA-binding protein, P67 [Arabidopsis thaliana]
           GI:9755842
          Length = 688

 Score = 27.9 bits (59), Expect = 6.8
 Identities = 13/44 (29%), Positives = 24/44 (54%), Gaps = 4/44 (9%)
 Frame = +2

Query: 305 DEYGRRARVELRSASWHRGLQELWRL----FAVVVRMLGNVGDW 424
           D YGR   V++  + + R   E WR+    F+ ++R+ G  G++
Sbjct: 239 DAYGRAGNVDMALSLYDRARTEKWRIDAVTFSTLIRIYGVSGNY 282


>At4g03430.1 68417.m00470 pre-mRNA splicing factor-related similar
           to pre-mRNA splicing factor pre-mRNA splicing factor
           prp1 (SP:Q12381) [Fission yeast]
          Length = 1029

 Score = 27.9 bits (59), Expect = 6.8
 Identities = 14/32 (43%), Positives = 18/32 (56%)
 Frame = +2

Query: 320 RARVELRSASWHRGLQELWRLFAVVVRMLGNV 415
           RAR+ L  A    G + +W   A+V R LGNV
Sbjct: 745 RARMLLAKARERGGTERVWMKSAIVERELGNV 776


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 14,753,276
Number of Sequences: 28952
Number of extensions: 282126
Number of successful extensions: 792
Number of sequences better than 10.0: 12
Number of HSP's better than 10.0 without gapping: 770
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 791
length of database: 12,070,560
effective HSP length: 79
effective length of database: 9,783,352
effective search space used: 1496852856
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).