SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= tesS0010
         (598 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At3g10320.1 68416.m01238 expressed protein contains Pfam domain,...    29   1.8  
At5g61060.1 68418.m07662 histone deacetylase family protein simi...    29   3.1  
At5g64300.1 68418.m08077 riboflavin biosynthesis protein, putati...    27   9.5  
At3g16890.1 68416.m02159 pentatricopeptide (PPR) repeat-containi...    27   9.5  
At2g22450.1 68415.m02662 riboflavin biosynthesis protein, putati...    27   9.5  

>At3g10320.1 68416.m01238 expressed protein contains Pfam domain,
           PF04577: Protein of unknown function (DUF563)
          Length = 494

 Score = 29.5 bits (63), Expect = 1.8
 Identities = 16/53 (30%), Positives = 28/53 (52%), Gaps = 3/53 (5%)
 Frame = +3

Query: 216 KQVDIDSNGIRLLDKYSFXCEMYDEDADEIKD---LTLNYFPFDNSVQIIDAK 365
           K++ +D NG ++L + S   E YD+D   +KD   +T   + F   + + D K
Sbjct: 421 KKLGLDYNGYKILPRESSLYEKYDKDDPILKDPNSITKKGWQFTKGIYLNDQK 473


>At5g61060.1 68418.m07662 histone deacetylase family protein similar
           to SP|Q9UBN7 Histone deacetylase 6 (HD6) {Homo sapiens};
           contains Pfam profile PF00850: Histone deacetylase
           family
          Length = 660

 Score = 28.7 bits (61), Expect = 3.1
 Identities = 8/29 (27%), Positives = 19/29 (65%)
 Frame = +1

Query: 37  HIYIIHNREFVSLMRRLCANKTDYKNKRI 123
           H+ ++H ++ V+L++ +   + DY+  RI
Sbjct: 81  HLQLVHTKDHVNLVKSISTKQKDYRRNRI 109


>At5g64300.1 68418.m08077 riboflavin biosynthesis protein, putative
           (RIBA) similar to SP|P47924 {Arabidopsis thaliana},
           SP|P51695 Riboflavin biosynthesis protein ribA
           [Includes: GTP cyclohydrolase II (EC 3.5.4.25);
           3,4-dihydroxy-2-butanone 4-phosphate synthase (DHBP
           synthase)] {Bacillus amyloliquefaciens}; contains Pfam
           profiles PF00925: GTP cyclohydrolase II, PF00926:
           3,4-dihydroxy-2-butanone 4-phosphate synthase
          Length = 384

 Score = 27.1 bits (57), Expect = 9.5
 Identities = 11/48 (22%), Positives = 23/48 (47%)
 Frame = +3

Query: 213 HKQVDIDSNGIRLLDKYSFXCEMYDEDADEIKDLTLNYFPFDNSVQII 356
           H +  +D   +  LD     CE+ D+D    +   L  F  +N+++++
Sbjct: 111 HTEASVDLTVLAGLDPVGVLCEIVDDDGSMARLPKLREFAAENNLKVV 158


>At3g16890.1 68416.m02159 pentatricopeptide (PPR) repeat-containing
           protein contains Pfam profile PF01535: PPR repeat
          Length = 659

 Score = 27.1 bits (57), Expect = 9.5
 Identities = 22/83 (26%), Positives = 36/83 (43%)
 Frame = +3

Query: 246 RLLDKYSFXCEMYDEDADEIKDLTLNYFPFDNSVQIIDAKKGKNVLKRVQLPPLNLDMLQ 425
           R+ +   F  EM D        +T N F    SV+  D KK   VL+++ +     D++ 
Sbjct: 440 RIENAAMFLTEMQDRGISP-NLVTFNTFLSGYSVRG-DVKKVHGVLEKLLVHGFKPDVIT 497

Query: 426 IGNIVNIFSKLLYIQDCGSCYTE 494
              I+N   +   I+D   C+ E
Sbjct: 498 FSLIINCLCRAKEIKDAFDCFKE 520


>At2g22450.1 68415.m02662 riboflavin biosynthesis protein, putative
           similar to SP|P50855 Riboflavin biosynthesis protein
           ribA [Includes: GTP cyclohydrolase II (EC 3.5.4.25);
           3,4-dihydroxy-2-butanone 4-phosphate synthase (DHBP
           synthase)] {Actinobacillus pleuropneumoniae}; contains
           Pfam profiles PF00925: GTP cyclohydrolase II, PF00926:
           3,4-dihydroxy-2-butanone 4-phosphate synthase
          Length = 476

 Score = 27.1 bits (57), Expect = 9.5
 Identities = 12/48 (25%), Positives = 24/48 (50%)
 Frame = +3

Query: 213 HKQVDIDSNGIRLLDKYSFXCEMYDEDADEIKDLTLNYFPFDNSVQII 356
           H +  +D   +  L+  S  CE+ D+D    +   L  F  +N++++I
Sbjct: 248 HTEASVDLTVLAGLEPVSVLCEIVDDDGSMARLPRLRQFAQENNLKLI 295


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 11,721,231
Number of Sequences: 28952
Number of extensions: 211457
Number of successful extensions: 530
Number of sequences better than 10.0: 5
Number of HSP's better than 10.0 without gapping: 524
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 530
length of database: 12,070,560
effective HSP length: 77
effective length of database: 9,841,256
effective search space used: 1190791976
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).