SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= tesS0007
         (618 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At1g53645.1 68414.m06102 hydroxyproline-rich glycoprotein family...    29   2.5  
At3g43528.1 68416.m04620 hypothetical protein                          28   4.3  
At5g66300.1 68418.m08359 no apical meristem (NAM) family protein...    27   7.5  
At5g19400.1 68418.m02312 expressed protein                             27   10.0 
At3g48900.1 68416.m05342 single-strand DNA endonuclease, putativ...    27   10.0 
At2g01860.1 68415.m00119 pentatricopeptide (PPR) repeat-containi...    27   10.0 

>At1g53645.1 68414.m06102 hydroxyproline-rich glycoprotein family
           protein
          Length = 523

 Score = 29.1 bits (62), Expect = 2.5
 Identities = 18/48 (37%), Positives = 24/48 (50%), Gaps = 2/48 (4%)
 Frame = +1

Query: 229 PNSTSRDKIVVETGENRQFIH--INEPPIIVQEHDSQPQEKVCSTTKD 366
           P+   R K +VE+   RQ  +  I  PP   Q+   QPQ+K   T KD
Sbjct: 214 PSGAGRGKPLVESAPIRQEDNRQIRRPPPPPQQQRVQPQQKRAPTVKD 261


>At3g43528.1 68416.m04620 hypothetical protein
          Length = 81

 Score = 28.3 bits (60), Expect = 4.3
 Identities = 11/28 (39%), Positives = 18/28 (64%)
 Frame = +3

Query: 510 RNLRRTYIRLLKKNRLGKEIKWVLIITC 593
           RN  R    L++KN+ GK+ K V++ +C
Sbjct: 39  RNQERMERDLMEKNKRGKDFKMVIVFSC 66


>At5g66300.1 68418.m08359 no apical meristem (NAM) family protein
           similar to NAC2 (GI:6456751)  [Arabidopsis thaliana];
           contains Pfam PF02365 : No apical meristem (NAM) protein
          Length = 292

 Score = 27.5 bits (58), Expect = 7.5
 Identities = 10/34 (29%), Positives = 17/34 (50%)
 Frame = +2

Query: 104 LFRYFSLKMDMNNPPNQSYWFVLREDQSNVILST 205
           +  Y+SL+   N+PP +  W V R  +    + T
Sbjct: 135 IHEYYSLESHQNSPPQEEGWVVCRAFKKRTTIPT 168


>At5g19400.1 68418.m02312 expressed protein
          Length = 1093

 Score = 27.1 bits (57), Expect = 10.0
 Identities = 14/35 (40%), Positives = 21/35 (60%), Gaps = 1/35 (2%)
 Frame = +2

Query: 140 NPPNQSYWFVLREDQSNVILSTNNFVNQ-NPQIPL 241
           NPP+ +   +LRE    +IL ++ F  Q N +IPL
Sbjct: 37  NPPDPNLLQLLREKYEAIILESHTFSEQHNIEIPL 71


>At3g48900.1 68416.m05342 single-strand DNA endonuclease, putative
           similar to single-strand DNA endonuclease-1 [Oryza
           sativa (japonica cultivar-group)]
           gi|16923283|dbj|BAB72003
          Length = 337

 Score = 27.1 bits (57), Expect = 10.0
 Identities = 10/21 (47%), Positives = 13/21 (61%)
 Frame = +2

Query: 161 WFVLREDQSNVILSTNNFVNQ 223
           WF+L  D  N I+S N F N+
Sbjct: 171 WFLLPSDMVNSIISPNKFANE 191


>At2g01860.1 68415.m00119 pentatricopeptide (PPR) repeat-containing
           protein contains Pfam profile PF01535: PPR repeat
          Length = 486

 Score = 27.1 bits (57), Expect = 10.0
 Identities = 15/63 (23%), Positives = 27/63 (42%)
 Frame = +1

Query: 220 SKSPNSTSRDKIVVETGENRQFIHINEPPIIVQEHDSQPQEKVCSTTKDVFWDRSKIRLL 399
           +K+  +  R K+  + G N         P+++ + D Q QE V      V W+  +I  +
Sbjct: 42  TKNLRNPRRTKLPPDFGVNLFLRKPKIEPLVIDDDDEQVQESVNDDDDAVVWEPEEIEAI 101

Query: 400 LKL 408
             L
Sbjct: 102 SSL 104


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 12,578,388
Number of Sequences: 28952
Number of extensions: 240682
Number of successful extensions: 565
Number of sequences better than 10.0: 6
Number of HSP's better than 10.0 without gapping: 552
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 565
length of database: 12,070,560
effective HSP length: 78
effective length of database: 9,812,304
effective search space used: 1246162608
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).