SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= tesS0006
         (698 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At1g06710.1 68414.m00713 pentatricopeptide (PPR) repeat-containi...    31   0.73 
At5g46100.1 68418.m05668 pentatricopeptide (PPR) repeat-containi...    29   3.0  
At4g25170.1 68417.m03624 expressed protein                             28   5.2  
At4g20090.1 68417.m02938 pentatricopeptide (PPR) repeat-containi...    28   5.2  
At4g19440.1 68417.m02860 pentatricopeptide (PPR) repeat-containi...    28   5.2  
At2g38330.1 68415.m04709 MATE efflux family protein low similari...    28   5.2  
At1g01730.1 68414.m00092 expressed protein                             28   5.2  

>At1g06710.1 68414.m00713 pentatricopeptide (PPR) repeat-containing
           protein low similarity to fertility restorer [Petunia x
           hybrida] GI:22128587; contains Pfam profile PF01535: PPR
           repeat
          Length = 946

 Score = 31.1 bits (67), Expect = 0.73
 Identities = 20/87 (22%), Positives = 40/87 (45%), Gaps = 1/87 (1%)
 Frame = +2

Query: 221 TRRGILFRASERDHQDAANSIMGIVVEN-IEPHIHWKPQLIDGILKYGDRVHTMSLPRAS 397
           T   ++ R  +   QD A+ ++  ++EN   P++    ++IDG+ K G       L +  
Sbjct: 670 TYSSLIDRYFKVKRQDLASKVLSKMLENSCAPNVVIYTEMIDGLCKVGKTDEAYKLMQMM 729

Query: 398 APPGLRPNEIIDQFHVTNFNVRLEIES 478
              G +PN +     +  F +  +IE+
Sbjct: 730 EEKGCQPNVVTYTAMIDGFGMIGKIET 756


>At5g46100.1 68418.m05668 pentatricopeptide (PPR) repeat-containing
           protein contains Pfam profile PF01535: PPR repeat
          Length = 472

 Score = 29.1 bits (62), Expect = 3.0
 Identities = 14/43 (32%), Positives = 21/43 (48%)
 Frame = +2

Query: 299 ENIEPHIHWKPQLIDGILKYGDRVHTMSLPRASAPPGLRPNEI 427
           + IEP++     L+DG+ K G  +  M L       G RPN +
Sbjct: 256 KGIEPNVFTYSSLMDGLCKDGRSLQAMELFEMMMARGCRPNMV 298


>At4g25170.1 68417.m03624 expressed protein
          Length = 344

 Score = 28.3 bits (60), Expect = 5.2
 Identities = 20/70 (28%), Positives = 28/70 (40%)
 Frame = +2

Query: 488 TGELKAGKQVPYLT*REPSIDSLKATSTE*FALSHTALRCGKPQTTRLFACGSLML*VPM 667
           TG    G Q P+ +    S  S    ++        +   G    T   A G L+L +P+
Sbjct: 26  TGVANGGIQDPFASSSSSSTSSPAGNASVSHVQKQRSSSSGSNNLTYSAASG-LLLNLPV 84

Query: 668 GRTSSWXGGG 697
             TS W GGG
Sbjct: 85  AATSGWSGGG 94


>At4g20090.1 68417.m02938 pentatricopeptide (PPR) repeat-containing
           protein contains Pfam profile PF01535: PPR repeat
          Length = 660

 Score = 28.3 bits (60), Expect = 5.2
 Identities = 17/60 (28%), Positives = 25/60 (41%)
 Frame = +2

Query: 251 ERDHQDAANSIMGIVVENIEPHIHWKPQLIDGILKYGDRVHTMSLPRASAPPGLRPNEII 430
           +R   DA   +  +       + H    LI G+ K G     MSL R  A  G +PN ++
Sbjct: 340 QRRATDAVRLLSSMEERGYHLNQHIYSVLISGLFKEGKAEEAMSLWRKMAEKGCKPNIVV 399


>At4g19440.1 68417.m02860 pentatricopeptide (PPR) repeat-containing
           protein contains Pfam profile PF01535: PPR repeat
          Length = 825

 Score = 28.3 bits (60), Expect = 5.2
 Identities = 15/44 (34%), Positives = 21/44 (47%)
 Frame = +2

Query: 296 VENIEPHIHWKPQLIDGILKYGDRVHTMSLPRASAPPGLRPNEI 427
           +E +EP++     LIDG  K G  V    L R      + PN+I
Sbjct: 708 MEGLEPNVFHYTALIDGYGKLGQMVKVECLLREMHSKNVHPNKI 751


>At2g38330.1 68415.m04709 MATE efflux family protein low similarity
           to enhanced disease susceptibility 5 [Arabidopsis
           thaliana] GI:16589070; contains Pfam profile PF01554:
           Uncharacterized membrane protein family
          Length = 521

 Score = 28.3 bits (60), Expect = 5.2
 Identities = 24/82 (29%), Positives = 37/82 (45%), Gaps = 8/82 (9%)
 Frame = +2

Query: 179 PHQPRPSFGQRKTGTRRGILFRASERDHQDAANSIM--------GIVVENIEPHIHWKPQ 334
           PH+    FG   +  RR I+ ++S RD   A ++           +  +N   H H KP 
Sbjct: 12  PHRSPSRFGNPNSSIRRTIVCKSSPRDESPAVSTSSQRPEKQQNPLTSQNKPDHDH-KPD 70

Query: 335 LIDGILKYGDRVHTMSLPRASA 400
              GI K G  + +++LP A A
Sbjct: 71  --PGIGKIGMEIMSIALPAALA 90


>At1g01730.1 68414.m00092 expressed protein
          Length = 224

 Score = 28.3 bits (60), Expect = 5.2
 Identities = 11/26 (42%), Positives = 17/26 (65%)
 Frame = +1

Query: 247 IGTRSPGRGELYNGYSGREHRTSHPL 324
           I +  PG   +Y+G S  E+R+SHP+
Sbjct: 186 ITSGGPGTEPVYSGMSKEEYRSSHPI 211


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 13,280,483
Number of Sequences: 28952
Number of extensions: 240749
Number of successful extensions: 678
Number of sequences better than 10.0: 7
Number of HSP's better than 10.0 without gapping: 663
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 678
length of database: 12,070,560
effective HSP length: 79
effective length of database: 9,783,352
effective search space used: 1496852856
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).