SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= tesS0005
         (698 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At1g68200.1 68414.m07791 zinc finger (CCCH-type) family protein ...    71   6e-13
At1g66810.1 68414.m07594 zinc finger (CCCH-type) family protein ...    71   6e-13
At2g35430.1 68415.m04342 zinc finger (CCCH-type) family protein ...    44   3e-05
At1g32360.1 68414.m03989 zinc finger (CCCH-type) family protein ...    44   1e-04
At5g06770.1 68418.m00765 KH domain-containing protein / zinc fin...    42   4e-04
At3g19360.1 68416.m02456 zinc finger (CCCH-type) family protein ...    40   0.002
At3g12130.1 68416.m01509 KH domain-containing protein / zinc fin...    39   0.003
At1g03790.1 68414.m00360 zinc finger (CCCH-type) family protein ...    37   0.015
At5g56900.2 68418.m07101 CwfJ-like family protein / zinc finger ...    34   0.079
At5g56900.1 68418.m07100 CwfJ-like family protein / zinc finger ...    34   0.079
At5g44260.1 68418.m05416 zinc finger (CCCH-type) family protein ...    34   0.10 
At5g06420.2 68418.m00719 zinc finger (CCCH-type/C3HC4-type RING ...    34   0.10 
At5g06420.1 68418.m00718 zinc finger (CCCH-type/C3HC4-type RING ...    34   0.10 
At1g01350.1 68414.m00050 zinc finger (CCCH-type/C3HC4-type RING ...    34   0.10 
At3g21810.1 68416.m02750 zinc finger (CCCH-type) family protein ...    33   0.24 
At1g04990.2 68414.m00500 zinc finger (CCCH-type) family protein ...    33   0.24 
At1g04990.1 68414.m00499 zinc finger (CCCH-type) family protein ...    33   0.24 
At2g28450.1 68415.m03456 zinc finger (CCCH-type) family protein ...    31   0.56 
At2g46250.1 68415.m05751 myosin heavy chain-related contains wea...    31   0.73 
At5g57790.1 68418.m08529 expressed protein                             31   0.97 
At1g75340.1 68414.m08751 zinc finger (CCCH-type) family protein ...    30   1.3  
At5g04390.1 68418.m00431 zinc finger (C2H2 type) family protein ...    29   2.2  
At3g55980.1 68416.m06220 zinc finger (CCCH-type) family protein ...    29   2.2  
At2g40140.1 68415.m04937 zinc finger (CCCH-type) family protein ...    29   2.2  
At1g72040.1 68414.m08327 deoxynucleoside kinase family contains ...    29   2.2  
At2g05160.1 68415.m00543 zinc finger (CCCH-type) family protein ...    29   3.0  
At4g25440.1 68417.m03663 WD-40 repeat family protein / zfwd1 pro...    29   3.9  
At1g30460.1 68414.m03723 zinc finger (CCCH-type) family protein ...    29   3.9  
At1g01110.1 68414.m00014 expressed protein contains Prosite PS00...    29   3.9  
At5g07500.1 68418.m00858 zinc finger (CCCH-type) family protein ...    28   5.2  
At4g34350.1 68417.m04881 LytB family protein contains Pfam profi...    28   5.2  
At3g53330.1 68416.m05884 plastocyanin-like domain-containing pro...    28   5.2  
At3g48440.1 68416.m05288 zinc finger (CCCH-type) family protein ...    28   5.2  
At2g32930.1 68415.m04037 zinc finger (CCCH-type) family protein ...    28   5.2  
At5g19800.1 68418.m02353 hydroxyproline-rich glycoprotein family...    28   6.8  
At4g29190.1 68417.m04176 zinc finger (CCCH-type) family protein ...    28   6.8  
At1g59720.1 68414.m06720 pentatricopeptide (PPR) repeat-containi...    28   6.8  
At5g63260.1 68418.m07940 zinc finger (CCCH-type) family protein ...    27   9.0  
At3g52980.1 68416.m05840 RNA recognition motif (RRM)-containing ...    27   9.0  
At2g45250.1 68415.m05633 expressed protein                             27   9.0  
At1g62950.1 68414.m07108 leucine-rich repeat transmembrane prote...    27   9.0  

>At1g68200.1 68414.m07791 zinc finger (CCCH-type) family protein
           contains Pfam domain, PF00642: Zinc finger
           C-x8-C-x5-C-x3-H type (and similar)
          Length = 308

 Score = 71.3 bits (167), Expect = 6e-13
 Identities = 28/50 (56%), Positives = 36/50 (72%)
 Frame = +1

Query: 256 CQFAHGVRELRNLQRHPKYKTELCRTFHSVGFCPYGPRCHFVHNAEEARR 405
           CQFAHG++ELR + RHP+YKTE+CR   +   CPYG RCHF H+  E  +
Sbjct: 243 CQFAHGIKELRPVIRHPRYKTEVCRMVLAGDNCPYGHRCHFRHSLSEQEK 292



 Score = 41.1 bits (92), Expect = 7e-04
 Identities = 15/30 (50%), Positives = 17/30 (56%)
 Frame = +1

Query: 313 KTELCRTFHSVGFCPYGPRCHFVHNAEEAR 402
           KTELC  +   G CPYG  C F H  +E R
Sbjct: 224 KTELCNKWQETGTCPYGDHCQFAHGIKELR 253



 Score = 31.9 bits (69), Expect = 0.42
 Identities = 11/19 (57%), Positives = 14/19 (73%)
 Frame = +2

Query: 200 KTELCRPFEEAGVCKYGDN 256
           KTELC  ++E G C YGD+
Sbjct: 224 KTELCNKWQETGTCPYGDH 242


>At1g66810.1 68414.m07594 zinc finger (CCCH-type) family protein
           contains Pfam domain, PF00642: Zinc finger
           C-x8-C-x5-C-x3-H type (and similar)
          Length = 310

 Score = 71.3 bits (167), Expect = 6e-13
 Identities = 28/50 (56%), Positives = 35/50 (70%)
 Frame = +1

Query: 256 CQFAHGVRELRNLQRHPKYKTELCRTFHSVGFCPYGPRCHFVHNAEEARR 405
           CQFAHG+ ELR + RHP+YKTE+CR   +   CPYG RCHF H+  +  R
Sbjct: 253 CQFAHGIDELRPVIRHPRYKTEVCRMMVTGAMCPYGHRCHFRHSLTDQER 302



 Score = 39.5 bits (88), Expect = 0.002
 Identities = 19/46 (41%), Positives = 22/46 (47%), Gaps = 2/46 (4%)
 Frame = +1

Query: 271 GVRELRNLQ--RHPKYKTELCRTFHSVGFCPYGPRCHFVHNAEEAR 402
           G RE   L+  R    KTELC  +   G C YG  C F H  +E R
Sbjct: 218 GEREALELEVYRQGMMKTELCNKWQETGACCYGDNCQFAHGIDELR 263



 Score = 33.1 bits (72), Expect = 0.18
 Identities = 12/19 (63%), Positives = 14/19 (73%)
 Frame = +2

Query: 200 KTELCRPFEEAGVCKYGDN 256
           KTELC  ++E G C YGDN
Sbjct: 234 KTELCNKWQETGACCYGDN 252


>At2g35430.1 68415.m04342 zinc finger (CCCH-type) family protein
           contains Pfam domain, PF00642: Zinc finger
           C-x8-C-x5-C-x3-H type (and similar)
          Length = 252

 Score = 44.4 bits (100), Expect(2) = 3e-05
 Identities = 13/33 (39%), Positives = 20/33 (60%)
 Frame = +1

Query: 298 RHPKYKTELCRTFHSVGFCPYGPRCHFVHNAEE 396
           + P +KT +C  + + G+CP+G  CHF H   E
Sbjct: 140 KSPNWKTRICNKWQTTGYCPFGSHCHFAHGPSE 172



 Score = 37.5 bits (83), Expect = 0.008
 Identities = 17/32 (53%), Positives = 21/32 (65%), Gaps = 1/32 (3%)
 Frame = +1

Query: 310 YKTELCRTFHSVGFCPYGPR-CHFVHNAEEAR 402
           +KT+LC  F + G CPY    CHF H+AEE R
Sbjct: 72  FKTKLCFKFRA-GTCPYSASSCHFAHSAEELR 102



 Score = 20.6 bits (41), Expect(2) = 3e-05
 Identities = 7/11 (63%), Positives = 7/11 (63%)
 Frame = +1

Query: 256 CQFAHGVRELR 288
           C FAH   ELR
Sbjct: 92  CHFAHSAEELR 102


>At1g32360.1 68414.m03989 zinc finger (CCCH-type) family protein
           contains Pfam domain, PF00642: Zinc finger
           C-x8-C-x5-C-x3-H type (and similar)
          Length = 384

 Score = 44.0 bits (99), Expect = 1e-04
 Identities = 14/32 (43%), Positives = 20/32 (62%)
 Frame = +1

Query: 310 YKTELCRTFHSVGFCPYGPRCHFVHNAEEARR 405
           +KT +C  +   G+CP+G +CHF H A E  R
Sbjct: 261 WKTRICNKWEITGYCPFGAKCHFAHGAAELHR 292



 Score = 37.9 bits (84), Expect = 0.006
 Identities = 16/32 (50%), Positives = 20/32 (62%)
 Frame = +1

Query: 310 YKTELCRTFHSVGFCPYGPRCHFVHNAEEARR 405
           +KT+LC  F + G CPY   C+F H  EE RR
Sbjct: 92  FKTKLCCKFRA-GTCPYITNCNFAHTVEELRR 122



 Score = 33.9 bits (74), Expect = 0.10
 Identities = 14/34 (41%), Positives = 21/34 (61%)
 Frame = +1

Query: 310 YKTELCRTFHSVGFCPYGPRCHFVHNAEEARRRE 411
           +K   C+ F++   CPYG  C F+H+ E +R RE
Sbjct: 173 FKGRHCKKFYTEEGCPYGESCTFLHD-EASRNRE 205


>At5g06770.1 68418.m00765 KH domain-containing protein / zinc finger
           (CCCH type) family protein contains Pfam domains
           PF00013: KH domain and PF00642: Zinc finger
           C-x8-C-x5-C-x3-H type (and similar)
          Length = 240

 Score = 41.9 bits (94), Expect = 4e-04
 Identities = 19/37 (51%), Positives = 22/37 (59%), Gaps = 2/37 (5%)
 Frame = +1

Query: 301 HP--KYKTELCRTFHSVGFCPYGPRCHFVHNAEEARR 405
           HP   YKT++C  + S G C YG RCHF H   E RR
Sbjct: 201 HPGSNYKTKICDRY-SKGNCTYGDRCHFAHGESELRR 236



 Score = 35.1 bits (77), Expect = 0.045
 Identities = 13/41 (31%), Positives = 21/41 (51%)
 Frame = +1

Query: 262 FAHGVRELRNLQRHPKYKTELCRTFHSVGFCPYGPRCHFVH 384
           F    +E+ ++      K++ C  F S   CP+G  CHF+H
Sbjct: 21  FKRSKQEMESISTGLGSKSKPCTKFFSTSGCPFGDNCHFLH 61


>At3g19360.1 68416.m02456 zinc finger (CCCH-type) family protein
           contains Pfam domain, PF00642: Zinc finger
           C-x8-C-x5-C-x3-H type (and similar)
          Length = 386

 Score = 39.9 bits (89), Expect = 0.002
 Identities = 14/29 (48%), Positives = 17/29 (58%)
 Frame = +1

Query: 310 YKTELCRTFHSVGFCPYGPRCHFVHNAEE 396
           +KT LC  F   G CP+G +CHF H   E
Sbjct: 270 WKTRLCMKFDITGQCPFGDKCHFAHGQAE 298



 Score = 33.1 bits (72), Expect = 0.18
 Identities = 12/24 (50%), Positives = 16/24 (66%)
 Frame = +1

Query: 313 KTELCRTFHSVGFCPYGPRCHFVH 384
           + +LCR F     CPYG RC+F+H
Sbjct: 185 RMKLCRKFCFGEECPYGDRCNFIH 208



 Score = 31.9 bits (69), Expect = 0.42
 Identities = 13/32 (40%), Positives = 18/32 (56%)
 Frame = +1

Query: 310 YKTELCRTFHSVGFCPYGPRCHFVHNAEEARR 405
           YKT +C  F + G C  G  C+F H  E+ R+
Sbjct: 105 YKTRMCAKFRA-GTCRNGELCNFAHGIEDLRQ 135


>At3g12130.1 68416.m01509 KH domain-containing protein / zinc finger
           (CCCH type) family protein
          Length = 248

 Score = 39.1 bits (87), Expect = 0.003
 Identities = 17/37 (45%), Positives = 22/37 (59%), Gaps = 2/37 (5%)
 Frame = +1

Query: 301 HP--KYKTELCRTFHSVGFCPYGPRCHFVHNAEEARR 405
           HP   +KT++C  F S G C +G RCHF H   E R+
Sbjct: 209 HPGSNFKTKICERF-SKGNCTFGDRCHFAHGEAELRK 244



 Score = 33.5 bits (73), Expect = 0.14
 Identities = 11/24 (45%), Positives = 15/24 (62%)
 Frame = +1

Query: 313 KTELCRTFHSVGFCPYGPRCHFVH 384
           K++ C  F S   CP+G  CHF+H
Sbjct: 38  KSKPCTKFFSTSGCPFGENCHFLH 61


>At1g03790.1 68414.m00360 zinc finger (CCCH-type) family protein
           contains Pfam domain, PF00642: Zinc finger
           C-x8-C-x5-C-x3-H type (and similar)
          Length = 393

 Score = 36.7 bits (81), Expect = 0.015
 Identities = 19/51 (37%), Positives = 22/51 (43%), Gaps = 1/51 (1%)
 Frame = +1

Query: 247 WG*CQFAH-GVRELRNLQRHPKYKTELCRTFHSVGFCPYGPRCHFVHNAEE 396
           W  C FAH G +  R   R  +Y  E+C  F   G C  G  C F H   E
Sbjct: 101 WTDCPFAHPGEKARRRDPRRFQYSGEVCPEFRRGGDCSRGDDCEFAHGVFE 151


>At5g56900.2 68418.m07101 CwfJ-like family protein / zinc finger
           (CCCH-type) family protein contains Pfam domain,
           PF00642: Zinc finger C-x8-C-x5-C-x3-H type (and
           similar), PF04677: Protein similar to CwfJ C-terminus 1,
           PF04676: Protein similar to CwfJ C-terminus 2
          Length = 593

 Score = 34.3 bits (75), Expect = 0.079
 Identities = 14/25 (56%), Positives = 15/25 (60%)
 Frame = +1

Query: 319 ELCRTFHSVGFCPYGPRCHFVHNAE 393
           +LC  F   G CP G  CHF HNAE
Sbjct: 304 KLCFKFVCSGSCPRGEDCHFQHNAE 328


>At5g56900.1 68418.m07100 CwfJ-like family protein / zinc finger
           (CCCH-type) family protein contains Pfam domain,
           PF00642: Zinc finger C-x8-C-x5-C-x3-H type (and
           similar), PF04677: Protein similar to CwfJ C-terminus 1,
           PF04676: Protein similar to CwfJ C-terminus 2
          Length = 404

 Score = 34.3 bits (75), Expect = 0.079
 Identities = 14/25 (56%), Positives = 15/25 (60%)
 Frame = +1

Query: 319 ELCRTFHSVGFCPYGPRCHFVHNAE 393
           +LC  F   G CP G  CHF HNAE
Sbjct: 115 KLCFKFVCSGSCPRGEDCHFQHNAE 139


>At5g44260.1 68418.m05416 zinc finger (CCCH-type) family protein
           contains Pfam domain, PF00642: Zinc finger
           C-x8-C-x5-C-x3-H type (and similar)
          Length = 381

 Score = 33.9 bits (74), Expect = 0.10
 Identities = 18/51 (35%), Positives = 21/51 (41%), Gaps = 1/51 (1%)
 Frame = +1

Query: 247 WG*CQFAH-GVRELRNLQRHPKYKTELCRTFHSVGFCPYGPRCHFVHNAEE 396
           W  C F+H G +  R   R   Y  E+C  F   G C  G  C F H   E
Sbjct: 79  WTDCPFSHPGEKARRRDPRRFHYTGEVCPEFSRHGDCSRGDECGFAHGVFE 129


>At5g06420.2 68418.m00719 zinc finger (CCCH-type/C3HC4-type RING
           finger) family protein contains Pfam domains PF00642:
           Zinc finger C-x8-C-x5-C-x3-H type (and similar) and
           PF00097: Zinc finger, C3HC4 type (RING finger)
          Length = 378

 Score = 33.9 bits (74), Expect = 0.10
 Identities = 9/26 (34%), Positives = 17/26 (65%)
 Frame = +1

Query: 310 YKTELCRTFHSVGFCPYGPRCHFVHN 387
           Y+ ++C+ +   G+C YG  C F+H+
Sbjct: 236 YQPDICKDYKETGYCGYGDSCKFLHD 261



 Score = 31.9 bits (69), Expect = 0.42
 Identities = 10/30 (33%), Positives = 18/30 (60%)
 Frame = +2

Query: 197 YKTELCRPFEEAGVCKYGDNANLLTASANY 286
           Y+ ++C+ ++E G C YGD+   L    +Y
Sbjct: 236 YQPDICKDYKETGYCGYGDSCKFLHDRGDY 265


>At5g06420.1 68418.m00718 zinc finger (CCCH-type/C3HC4-type RING
           finger) family protein contains Pfam domains PF00642:
           Zinc finger C-x8-C-x5-C-x3-H type (and similar) and
           PF00097: Zinc finger, C3HC4 type (RING finger)
          Length = 378

 Score = 33.9 bits (74), Expect = 0.10
 Identities = 9/26 (34%), Positives = 17/26 (65%)
 Frame = +1

Query: 310 YKTELCRTFHSVGFCPYGPRCHFVHN 387
           Y+ ++C+ +   G+C YG  C F+H+
Sbjct: 236 YQPDICKDYKETGYCGYGDSCKFLHD 261



 Score = 31.9 bits (69), Expect = 0.42
 Identities = 10/30 (33%), Positives = 18/30 (60%)
 Frame = +2

Query: 197 YKTELCRPFEEAGVCKYGDNANLLTASANY 286
           Y+ ++C+ ++E G C YGD+   L    +Y
Sbjct: 236 YQPDICKDYKETGYCGYGDSCKFLHDRGDY 265


>At1g01350.1 68414.m00050 zinc finger (CCCH-type/C3HC4-type RING
           finger) family protein similar to SP|O15541 Zinc finger
           protein 183 {Homo sapiens}; contains Pfam profiles
           PF04396: Protein of unknown function, DUF537, PF00097:
           Zinc finger, C3HC4 type (RING finger), PF00642: Zinc
           finger C-x8-C-x5-C-x3-H type (and similar)
          Length = 586

 Score = 33.9 bits (74), Expect = 0.10
 Identities = 9/26 (34%), Positives = 17/26 (65%)
 Frame = +1

Query: 310 YKTELCRTFHSVGFCPYGPRCHFVHN 387
           Y+ ++C+ +   G+C YG  C F+H+
Sbjct: 201 YQPDICKDYKETGYCGYGDSCKFLHD 226



 Score = 31.9 bits (69), Expect = 0.42
 Identities = 10/30 (33%), Positives = 18/30 (60%)
 Frame = +2

Query: 197 YKTELCRPFEEAGVCKYGDNANLLTASANY 286
           Y+ ++C+ ++E G C YGD+   L    +Y
Sbjct: 201 YQPDICKDYKETGYCGYGDSCKFLHDRGDY 230


>At3g21810.1 68416.m02750 zinc finger (CCCH-type) family protein
           contains Pfam domain, PF00642: Zinc finger
           C-x8-C-x5-C-x3-H type (and similar)
          Length = 437

 Score = 32.7 bits (71), Expect = 0.24
 Identities = 15/32 (46%), Positives = 17/32 (53%)
 Frame = +1

Query: 310 YKTELCRTFHSVGFCPYGPRCHFVHNAEEARR 405
           YKT+LC  F+  G C   P C F H   E RR
Sbjct: 7   YKTKLCILFNKTGDCS-RPNCTFAHGNAELRR 37


>At1g04990.2 68414.m00500 zinc finger (CCCH-type) family protein
           contains Pfam domain, PF00642: Zinc finger
           C-x8-C-x5-C-x3-H type (and similar)
          Length = 404

 Score = 32.7 bits (71), Expect = 0.24
 Identities = 11/20 (55%), Positives = 12/20 (60%)
 Frame = +1

Query: 325 CRTFHSVGFCPYGPRCHFVH 384
           C  F S GFC +GP C F H
Sbjct: 313 CGNFRSYGFCKFGPNCKFDH 332


>At1g04990.1 68414.m00499 zinc finger (CCCH-type) family protein
           contains Pfam domain, PF00642: Zinc finger
           C-x8-C-x5-C-x3-H type (and similar)
          Length = 404

 Score = 32.7 bits (71), Expect = 0.24
 Identities = 11/20 (55%), Positives = 12/20 (60%)
 Frame = +1

Query: 325 CRTFHSVGFCPYGPRCHFVH 384
           C  F S GFC +GP C F H
Sbjct: 313 CGNFRSYGFCKFGPNCKFDH 332


>At2g28450.1 68415.m03456 zinc finger (CCCH-type) family protein
           contains Pfam domain, PF00642: Zinc finger
           C-x8-C-x5-C-x3-H type (and similar)
          Length = 809

 Score = 31.5 bits (68), Expect = 0.56
 Identities = 12/35 (34%), Positives = 16/35 (45%)
 Frame = +1

Query: 304 PKYKTELCRTFHSVGFCPYGPRCHFVHNAEEARRR 408
           P +KT LC  F     C +G  C + H   E R +
Sbjct: 78  PWWKTSLCSYFRREASCSHGNECKYAHGEAELRMK 112


>At2g46250.1 68415.m05751 myosin heavy chain-related contains weak
           similarity to Myosin heavy chain, muscle
           (Swiss-Prot:P05661) [Drosophila melanogaster]
          Length = 468

 Score = 31.1 bits (67), Expect = 0.73
 Identities = 19/63 (30%), Positives = 32/63 (50%)
 Frame = +2

Query: 365 RVAISCITQRKQDAENHRRQEVHWHRSHRADLWRRI*ATGRDRHARRISIDASLSTCDVA 544
           R+ +    +R  D E+H R  +H H   RA L R+I AT   R+   +    S ++C  +
Sbjct: 73  RIELRRCRRRDSDVESHSRSPLHDHPPSRASLRRQIAATDDYRNGDLLQ-PISPASCSSS 131

Query: 545 TST 553
           +S+
Sbjct: 132 SSS 134


>At5g57790.1 68418.m08529 expressed protein
          Length = 205

 Score = 30.7 bits (66), Expect = 0.97
 Identities = 13/43 (30%), Positives = 23/43 (53%)
 Frame = +3

Query: 147 SNAPPVNRLLRHQPQVATRPSSADRLKKRGFVNMGIMPICSRR 275
           SN PP+   +   P   ++PS+ D +   GF ++GI  +  +R
Sbjct: 43  SNFPPLTTEIDTPPPSNSKPSTVDDISMEGFESLGIEKLIKKR 85


>At1g75340.1 68414.m08751 zinc finger (CCCH-type) family protein
           weak similarity to Nucleoporin NUP42 (Nuclear pore
           protein NUP42) (Swiss-Prot:P49686) [Saccharomyces
           cerevisiae]; contains Pfam profile  PF00642: Zinc finger
           C-x8-C-x5-C-x3-H type (and similar)
          Length = 435

 Score = 30.3 bits (65), Expect = 1.3
 Identities = 12/24 (50%), Positives = 14/24 (58%)
 Frame = +1

Query: 313 KTELCRTFHSVGFCPYGPRCHFVH 384
           + ELCR F   G C YG  C F+H
Sbjct: 2   RKELCRNFQR-GSCRYGENCRFLH 24



 Score = 27.9 bits (59), Expect = 6.8
 Identities = 11/23 (47%), Positives = 15/23 (65%)
 Frame = +2

Query: 200 KTELCRPFEEAGVCKYGDNANLL 268
           + ELCR F+  G C+YG+N   L
Sbjct: 2   RKELCRNFQR-GSCRYGENCRFL 23


>At5g04390.1 68418.m00431 zinc finger (C2H2 type) family protein
           contains Pfam domain, PF00096: Zinc finger, C2H2 type
          Length = 362

 Score = 29.5 bits (63), Expect = 2.2
 Identities = 12/35 (34%), Positives = 17/35 (48%)
 Frame = +2

Query: 515 DASLSTCDVATSTGHSFRFSPHELPRSGRRPTARF 619
           D  ++ C +  + GHS   + H LP S    T RF
Sbjct: 97  DQDIANCLILLAQGHSLPHNNHHLPNSNNNNTYRF 131


>At3g55980.1 68416.m06220 zinc finger (CCCH-type) family protein
           contains Pfam domain, PF00642: Zinc finger
           C-x8-C-x5-C-x3-H type (and similar) and Pfam domain,
           PF00023: Ankyrin repeat
          Length = 580

 Score = 29.5 bits (63), Expect = 2.2
 Identities = 17/52 (32%), Positives = 19/52 (36%), Gaps = 1/52 (1%)
 Frame = +1

Query: 247 WG*CQFAH-GVRELRNLQRHPKYKTELCRTFHSVGFCPYGPRCHFVHNAEEA 399
           W  C F H G    R   R   Y    C  F   G CP G  C + H   E+
Sbjct: 230 WTECAFVHPGENARRRDPRKYPYTCVPCPEFRK-GSCPKGDSCEYAHGVFES 280


>At2g40140.1 68415.m04937 zinc finger (CCCH-type) family protein
           contains Pfam domain, PF00642: Zinc finger
           C-x8-C-x5-C-x3-H type (and similar) and Pfam domain,
           PF00023: Ankyrin repeat
          Length = 597

 Score = 29.5 bits (63), Expect = 2.2
 Identities = 17/52 (32%), Positives = 19/52 (36%), Gaps = 1/52 (1%)
 Frame = +1

Query: 247 WG*CQFAH-GVRELRNLQRHPKYKTELCRTFHSVGFCPYGPRCHFVHNAEEA 399
           W  C F H G    R   R   Y    C  F   G CP G  C + H   E+
Sbjct: 233 WTECPFVHPGENARRRDPRKYPYTCVPCPEFRK-GSCPKGDSCEYAHGVFES 283


>At1g72040.1 68414.m08327 deoxynucleoside kinase family contains
           Pfam profile: PF01712 deoxynucleoside kinase
          Length = 580

 Score = 29.5 bits (63), Expect = 2.2
 Identities = 13/27 (48%), Positives = 18/27 (66%)
 Frame = -2

Query: 658 DERDRREPMKSRLKTGSRSSSGSGEFV 578
           DE + ++    R+   +RSSSGSGEFV
Sbjct: 149 DEDEEKDEKPVRMNRRNRSSSGSGEFV 175


>At2g05160.1 68415.m00543 zinc finger (CCCH-type) family protein /
           RNA recognition motif (RRM)-containing protein contains
           InterPro entry IPR000504: RNA-binding region RNP-1 (RNA
           recognition motif) (RRM)
          Length = 536

 Score = 29.1 bits (62), Expect = 3.0
 Identities = 11/37 (29%), Positives = 19/37 (51%)
 Frame = +1

Query: 274 VRELRNLQRHPKYKTELCRTFHSVGFCPYGPRCHFVH 384
           +R  R     P++  ++C  F+  GFC +G  C + H
Sbjct: 145 LRTSRRSPSLPEFPVKICHYFNK-GFCKHGNNCRYFH 180


>At4g25440.1 68417.m03663 WD-40 repeat family protein / zfwd1
           protein (ZFWD1) identical to zfwd1 protein (GI:12057164)
           [Arabidopsis thaliana]
          Length = 430

 Score = 28.7 bits (61), Expect = 3.9
 Identities = 11/24 (45%), Positives = 14/24 (58%)
 Frame = +1

Query: 313 KTELCRTFHSVGFCPYGPRCHFVH 384
           KTE    F   G CPYG +C ++H
Sbjct: 103 KTEKLCKFWVDGNCPYGDKCRYLH 126


>At1g30460.1 68414.m03723 zinc finger (CCCH-type) family protein /
           YT521-B-like family protein low similarity to cleavage
           and polyadenylation specificity factor 30 kDa subunit
           [Bos taurus] GI:2327052; contains Pfam profiles PF00642:
           Zinc finger C-x8-C-x5-C-x3-H type (and similar),
           PF04146: YT521-B-like family; supporting cDNA
           gi|24415581|gb|AY140901.1|
          Length = 678

 Score = 28.7 bits (61), Expect = 3.9
 Identities = 12/36 (33%), Positives = 18/36 (50%)
 Frame = +1

Query: 277 RELRNLQRHPKYKTELCRTFHSVGFCPYGPRCHFVH 384
           RE   + +H     + C  +  +GFCP GP C + H
Sbjct: 104 REQDCVYKHTNEDIKECNMY-KLGFCPNGPDCRYRH 138


>At1g01110.1 68414.m00014 expressed protein contains Prosite
           PS00165: Serine/threonine dehydratases
           pyridoxal-phosphate attachment site
          Length = 364

 Score = 28.7 bits (61), Expect = 3.9
 Identities = 23/92 (25%), Positives = 35/92 (38%)
 Frame = +2

Query: 386 TQRKQDAENHRRQEVHWHRSHRADLWRRI*ATGRDRHARRISIDASLSTCDVATSTGHSF 565
           T   Q  E H   E+   R    D W       + R + R S+D  +S   V   T   +
Sbjct: 105 TVGNQSTEGHHEVELEEERPKWLDRWMATRPWDK-RASSRASVDQRVSVKTVEIDTSQPY 163

Query: 566 RFSPHELPRSGRRPTARF*PTFHRLSAISFIA 661
             +    P  G+RP++    + H  S  +F A
Sbjct: 164 SRTGAGSPSRGQRPSSPSRTSHHYQSRNNFSA 195


>At5g07500.1 68418.m00858 zinc finger (CCCH-type) family protein
           contains Pfam domain, PF00642: Zinc finger
           C-x8-C-x5-C-x3-H type (and similar)
          Length = 245

 Score = 28.3 bits (60), Expect = 5.2
 Identities = 19/53 (35%), Positives = 25/53 (47%), Gaps = 1/53 (1%)
 Frame = +1

Query: 256 CQFAHGVRELRNLQRHP-KYKTELCRTFHSVGFCPYGPRCHFVHNAEEARRRE 411
           C+FAHGV E      HP +Y+T  C    + G       C F H  E+ R+ E
Sbjct: 112 CEFAHGVFE---YWLHPARYRTRAC----NAGNLCQRKVCFFAHAPEQLRQSE 157


>At4g34350.1 68417.m04881 LytB family protein contains Pfam profile:
           PF02401 LytB protein
          Length = 466

 Score = 28.3 bits (60), Expect = 5.2
 Identities = 12/20 (60%), Positives = 14/20 (70%)
 Frame = -2

Query: 598 SGSGEFVRRKAKAVACAGGD 539
           SGSG   RRKA +V C+ GD
Sbjct: 24  SGSGSLRRRKALSVRCSSGD 43


>At3g53330.1 68416.m05884 plastocyanin-like domain-containing
           protein similar to mavicyanin SP:P80728 from [Cucurbita
           pepo]
          Length = 310

 Score = 28.3 bits (60), Expect = 5.2
 Identities = 14/41 (34%), Positives = 22/41 (53%)
 Frame = +3

Query: 510 PLTPHSPPAMSPPAQATAFAFRRTNSPDPEDDRLPVFNRLF 632
           P  P++PP   PP++    + R T SP P    LP F +++
Sbjct: 149 PSRPNTPPPPPPPSKTHEPSRRITPSPPPPSKILP-FGKIY 188


>At3g48440.1 68416.m05288 zinc finger (CCCH-type) family protein
           contains Pfam domain, PF00642: Zinc finger
           C-x8-C-x5-C-x3-H type (and similar)
          Length = 448

 Score = 28.3 bits (60), Expect = 5.2
 Identities = 8/24 (33%), Positives = 13/24 (54%)
 Frame = +1

Query: 322 LCRTFHSVGFCPYGPRCHFVHNAE 393
           +C  +   G C +GP C F H+ +
Sbjct: 397 ICTYYSRYGICKFGPACRFDHSVQ 420


>At2g32930.1 68415.m04037 zinc finger (CCCH-type) family protein
           contains Pfam domain, PF00642: Zinc finger
           C-x8-C-x5-C-x3-H type (and similar)
          Length = 453

 Score = 28.3 bits (60), Expect = 5.2
 Identities = 9/21 (42%), Positives = 12/21 (57%)
 Frame = +1

Query: 325 CRTFHSVGFCPYGPRCHFVHN 387
           C  F + GFC +G  C F H+
Sbjct: 313 CGNFKAYGFCKFGANCKFDHS 333



 Score = 27.5 bits (58), Expect = 9.0
 Identities = 10/23 (43%), Positives = 12/23 (52%)
 Frame = +1

Query: 325 CRTFHSVGFCPYGPRCHFVHNAE 393
           CR F + G C YG  C + H  E
Sbjct: 267 CRFFMNTGTCKYGDDCKYSHPKE 289


>At5g19800.1 68418.m02353 hydroxyproline-rich glycoprotein family
           protein similar to extensin [Catharanthus roseus]
           gi|1486263|dbj|BAA13175; contains proline-rich extensin
           domains, INTERPRO:IPR002965
          Length = 96

 Score = 27.9 bits (59), Expect = 6.8
 Identities = 12/29 (41%), Positives = 18/29 (62%)
 Frame = +3

Query: 510 PLTPHSPPAMSPPAQATAFAFRRTNSPDP 596
           P++P  PP   PP Q+ A A++R + P P
Sbjct: 46  PISPPPPPP-PPPPQSHAAAYKRYSPPPP 73


>At4g29190.1 68417.m04176 zinc finger (CCCH-type) family protein
           contains Pfam domain, PF00642: Zinc finger
           C-x8-C-x5-C-x3-H type (and similar)
          Length = 356

 Score = 27.9 bits (59), Expect = 6.8
 Identities = 21/60 (35%), Positives = 29/60 (48%), Gaps = 1/60 (1%)
 Frame = +1

Query: 226 RSGGL*IWG*CQFAHGVRELRNLQRHP-KYKTELCRTFHSVGFCPYGPRCHFVHNAEEAR 402
           R GG      C+FAHGV E      HP +Y+T+ C+     G C     C F H+ ++ R
Sbjct: 129 RKGGCKKGDSCEFAHGVFE---CWLHPARYRTQPCK---DGGNC-LRKICFFAHSPDQLR 181


>At1g59720.1 68414.m06720 pentatricopeptide (PPR) repeat-containing
           protein contains Pfam profile PF01535: PPR repeat
          Length = 638

 Score = 27.9 bits (59), Expect = 6.8
 Identities = 13/29 (44%), Positives = 17/29 (58%)
 Frame = +3

Query: 465 VVYERRVAIATLAAFPLTPHSPPAMSPPA 551
           + Y   ++I  L   PL+PH PPA SP A
Sbjct: 14  ITYYHPMSIGLLV-HPLSPHIPPASSPSA 41


>At5g63260.1 68418.m07940 zinc finger (CCCH-type) family protein
           contains Pfam domain, PF00642: Zinc finger
           C-x8-C-x5-C-x3-H type (and similar)
          Length = 435

 Score = 27.5 bits (58), Expect = 9.0
 Identities = 8/22 (36%), Positives = 12/22 (54%)
 Frame = +1

Query: 322 LCRTFHSVGFCPYGPRCHFVHN 387
           +C  +   G C +GP C F H+
Sbjct: 385 MCTHYSRYGICKFGPACRFDHS 406


>At3g52980.1 68416.m05840 RNA recognition motif (RRM)-containing
           protein predicted proteins, Arabidopsis thaliana
          Length = 381

 Score = 27.5 bits (58), Expect = 9.0
 Identities = 9/24 (37%), Positives = 15/24 (62%)
 Frame = +1

Query: 304 PKYKTELCRTFHSVGFCPYGPRCH 375
           P++  ++C  F+  GFC +G  CH
Sbjct: 163 PEFPLKICHYFNK-GFCKHGNNCH 185


>At2g45250.1 68415.m05633 expressed protein 
          Length = 204

 Score = 27.5 bits (58), Expect = 9.0
 Identities = 19/59 (32%), Positives = 27/59 (45%), Gaps = 2/59 (3%)
 Frame = +3

Query: 441 ALIGRIYGVVYERRVAIAT--LAAFPLTPHSPPAMSPPAQATAFAFRRTNSPDPEDDRL 611
           A  GR+  V   RRV + T   AA    P+ PP  +PP   ++ A  +   P P   +L
Sbjct: 68  AASGRL--VYVRRRVEVDTSKAAASTTNPNPPPTKAPPQIPSSPAQAQAQEPTPTSHKL 124


>At1g62950.1 68414.m07108 leucine-rich repeat transmembrane protein
           kinase, putative contains protein kinase domains
          Length = 890

 Score = 27.5 bits (58), Expect = 9.0
 Identities = 22/71 (30%), Positives = 35/71 (49%)
 Frame = +3

Query: 282 TTQSSASS*IQDGAVSHFPFGWLLSLWTALPFRA*RRGSKTQRTIVARRFIGIALIGRIY 461
           TT + AS+   +G V+   FG L+    +LP +     + T+  +     IGI  IG +Y
Sbjct: 559 TTPTQASTESGNGGVT---FGKLVLFSKSLPSKYEDWEAGTKALLDKDNIIGIGSIGAVY 615

Query: 462 GVVYERRVAIA 494
              +E  V+IA
Sbjct: 616 RASFEGGVSIA 626


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 14,597,055
Number of Sequences: 28952
Number of extensions: 293946
Number of successful extensions: 1194
Number of sequences better than 10.0: 41
Number of HSP's better than 10.0 without gapping: 1026
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1189
length of database: 12,070,560
effective HSP length: 79
effective length of database: 9,783,352
effective search space used: 1496852856
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).