SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= tesS0002
         (598 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At4g04695.1 68417.m00689 calcium-dependent protein kinase, putat...    49   2e-06
At4g09570.1 68417.m01575 calcium-dependent protein kinase, putat...    48   4e-06
At3g10660.1 68416.m01282 calcium-dependent protein kinase isofor...    48   4e-06
At1g35670.1 68414.m04435 calcium-dependent protein kinase 2 (CDP...    48   4e-06
At5g19360.1 68418.m02307 calcium-dependent protein kinase, putat...    48   6e-06
At5g12180.1 68418.m01429 calcium-dependent protein kinase, putat...    48   6e-06
At5g04870.1 68418.m00510 calcium-dependent protein kinase isofor...    46   1e-05
At4g04710.1 68417.m00692 calcium-dependent protein kinase, putat...    46   1e-05
At5g23580.1 68418.m02767 calcium-dependent protein kinase 9 (CDP...    45   3e-05
At4g35310.1 68417.m05019 calcium-dependent protein kinase, putat...    45   4e-05
At4g23650.1 68417.m03405 calcium-dependent protein kinase, putat...    44   1e-04
At2g17290.1 68415.m01997 calcium-dependent protein kinase isofor...    44   1e-04
At1g76040.2 68414.m08829 calcium-dependent protein kinase, putat...    44   1e-04
At1g76040.1 68414.m08830 calcium-dependent protein kinase, putat...    44   1e-04
At4g21940.1 68417.m03174 calcium-dependent protein kinase, putat...    43   1e-04
At3g51920.1 68416.m05695 calmodulin-9 (CAM9) identical to calmod...    43   1e-04
At3g20410.1 68416.m02585 calmodulin-domain protein kinase isofor...    43   1e-04
At4g37010.1 68417.m05243 caltractin, putative / centrin, putativ...    43   2e-04
At1g50700.1 68414.m05701 calcium-dependent protein kinase, putat...    43   2e-04
At1g61950.1 68414.m06988 calcium-dependent protein kinase, putat...    42   4e-04
At4g04720.1 68417.m00693 calcium-dependent protein kinase, putat...    41   5e-04
At2g31500.1 68415.m03848 calcium-dependent protein kinase, putat...    39   0.002
At4g04740.1 68417.m00695 calcium-dependent protein kinase, putat...    38   0.005
At3g17470.1 68416.m02232 RelA/SpoT domain-containing protein / c...    38   0.005
At5g12480.1 68418.m01466 calmodulin-domain protein kinase isofor...    38   0.007
At3g51850.1 68416.m05686 calcium-dependent protein kinase, putat...    38   0.007
At3g24110.1 68416.m03027 calcium-binding EF hand family protein ...    38   0.007
At5g37770.1 68418.m04547 touch-responsive protein / calmodulin-r...    37   0.009
At2g41100.2 68415.m05077 touch-responsive protein / calmodulin-r...    37   0.009
At2g41100.1 68415.m05076 touch-responsive protein / calmodulin-r...    37   0.009
At4g03290.1 68417.m00449 calcium-binding protein, putative simil...    37   0.012
At2g43290.1 68415.m05382 calmodulin-like protein (MSS3) identica...    36   0.016
At4g04700.1 68417.m00690 calcium-dependent protein kinase, putat...    36   0.021
At3g50770.1 68416.m05560 calmodulin-related protein, putative si...    36   0.021
At2g27030.3 68415.m03247 calmodulin-2/3/5 (CAM5) (TCH1) identica...    36   0.021
At1g32250.1 68414.m03967 calmodulin, putative similar to calmodu...    36   0.021
At5g37780.1 68418.m04549 calmodulin-1/4 (CAM1) identical to calm...    36   0.027
At2g41090.1 68415.m05075 calmodulin-like calcium-binding protein...    36   0.027
At1g66410.1 68414.m07542 calmodulin-1/4 (CAM4) identical to calm...    36   0.027
At1g74740.1 68414.m08660 calcium-dependent protein kinase, putat...    35   0.036
At1g18530.1 68414.m02312 calmodulin, putative similar to calmodu...    35   0.036
At5g21274.1 68418.m02533 calmodulin-6 (CAM6) identical to calmod...    35   0.047
At4g14640.1 68417.m02252 calmodulin-8 (CAM8) identical to calmod...    35   0.047
At3g56800.1 68416.m06317 calmodulin-2/3/5 (CAM3) identical to ca...    35   0.047
At2g41110.1 68415.m05078 calmodulin-2/3/5 (CAM2) (CAL1) almost i...    35   0.047
At2g27030.2 68415.m03246 calmodulin-2/3/5 (CAM5) (TCH1) identica...    35   0.047
At2g27030.1 68415.m03245 calmodulin-2/3/5 (CAM5) (TCH1) identica...    35   0.047
At3g43810.1 68416.m04682 calmodulin-7 (CAM7) almost identical to...    34   0.063
At3g03000.1 68416.m00295 calmodulin, putative similar to calmodu...    34   0.063
At1g76640.1 68414.m08918 calmodulin-related protein, putative si...    34   0.063
At1g66400.1 68414.m07541 calmodulin-related protein, putative si...    34   0.063
At1g18210.2 68414.m02267 calcium-binding protein, putative simil...    34   0.063
At1g18210.1 68414.m02266 calcium-binding protein, putative simil...    34   0.063
At5g07320.1 68418.m00836 mitochondrial substrate carrier family ...    34   0.083
At3g25600.1 68416.m03187 calmodulin, putative similar to calmodu...    34   0.083
At3g03430.1 68416.m00341 polcalcin, putative / calcium-binding p...    34   0.083
At2g15680.1 68415.m01795 calmodulin-related protein, putative si...    34   0.083
At1g18890.1 68414.m02351 calcium-dependent protein kinase 1 (CDP...    34   0.083
At5g42380.1 68418.m05160 calmodulin-related protein, putative si...    33   0.11 
At3g59440.1 68416.m06630 calcium-binding protein, putative simil...    33   0.11 
At3g07490.1 68416.m00893 calcium-binding protein, putative simil...    33   0.11 
At4g36070.1 68417.m05135 calcium-dependent protein kinase family...    33   0.14 
At4g32060.1 68417.m04563 calcium-binding EF hand family protein ...    33   0.19 
At3g22930.1 68416.m02889 calmodulin, putative strong similarity ...    33   0.19 
At3g10190.1 68416.m01220 calmodulin, putative similar to calmodu...    33   0.19 
At5g55990.1 68418.m06986 calcineurin B-like protein 2 (CBL2) ide...    32   0.25 
At4g26570.1 68417.m03830 calcineurin B-like protein 3 (CBL3) ide...    32   0.25 
At1g76650.1 68414.m08919 calcium-binding EF hand family protein ...    32   0.25 
At5g17470.1 68418.m02050 calmodulin-related protein, putative si...    32   0.33 
At2g44310.1 68415.m05513 calcium-binding EF hand family protein ...    31   0.44 
At4g26470.1 68417.m03808 calcium-binding EF hand family protein ...    31   0.58 
At3g03400.1 68416.m00337 calmodulin-related protein, putative si...    31   0.77 
At1g73630.1 68414.m08524 calcium-binding protein, putative simil...    30   1.0  
At1g05990.1 68414.m00627 calcium-binding protein, putative stron...    30   1.0  
At2g45670.1 68415.m05678 calcineurin B subunit-related contains ...    30   1.3  
At5g51050.1 68418.m06328 mitochondrial substrate carrier family ...    29   1.8  
At4g03560.1 68417.m00488 two-pore calcium channel (TPC1) identic...    29   1.8  
At3g03410.1 68416.m00339 calmodulin-related protein, putative si...    29   1.8  
At4g38230.1 68417.m05399 calcium-dependent protein kinase, putat...    29   2.4  
At5g57190.1 68418.m07144 phosphatidylserine decarboxylase, putat...    29   3.1  
At4g26560.1 68417.m03828 calcineurin B-like protein, putative si...    29   3.1  
At4g25970.1 68417.m03737 phosphatidylserine decarboxylase, putat...    29   3.1  
At4g26570.2 68417.m03831 calcineurin B-like protein 3 (CBL3) ide...    28   4.1  
At5g49150.1 68418.m06083 hypothetical protein                          28   5.4  
At1g55610.1 68414.m06365 protein kinase family protein contains ...    28   5.4  
At3g23950.1 68416.m03008 F-box family protein contains Pfam:PF00...    27   7.2  
At2g41860.2 68415.m05174 calcium-dependent protein kinase, putat...    27   7.2  
At2g41860.1 68415.m05173 calcium-dependent protein kinase, putat...    27   7.2  
At2g36180.1 68415.m04440 calmodulin-related protein, putative si...    27   7.2  
At2g15180.1 68415.m01731 zinc knuckle (CCHC-type) family protein...    27   7.2  
At4g15415.2 68417.m02357 serine/threonine protein phosphatase 2A...    27   9.5  
At4g15415.1 68417.m02356 serine/threonine protein phosphatase 2A...    27   9.5  
At3g13380.1 68416.m01683 leucine-rich repeat family protein / pr...    27   9.5  
At3g12720.1 68416.m01589 myb family transcription factor contain...    27   9.5  
At2g38910.1 68415.m04783 calcium-dependent protein kinase, putat...    27   9.5  
At2g35800.1 68415.m04396 mitochondrial substrate carrier family ...    27   9.5  

>At4g04695.1 68417.m00689 calcium-dependent protein kinase, putative
           / CDPK, putative similar to calcium-dependent protein
           kinase [Lycopersicon esculentum]
           gi|19171502|emb|CAC87494; contains protein kinase
           domain, Pfam:PF00069; contains EF hand domain
           (calcium-binding EF-hand), Pfam:PF00036,
           INTERPRO:IPR002048
          Length = 484

 Score = 49.2 bits (112), Expect = 2e-06
 Identities = 23/61 (37%), Positives = 34/61 (55%)
 Frame = +3

Query: 288 ILGLGRIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEF 467
           I GL  +F  +D D S  +  EE   G+   G  L+K+E E+L    D D +G+I +DEF
Sbjct: 334 IKGLKTLFTNIDTDKSGTITLEELKTGLTRLGSNLSKTEVEQLMEAADVDGNGTIDIDEF 393

Query: 468 L 470
           +
Sbjct: 394 I 394



 Score = 36.3 bits (80), Expect = 0.016
 Identities = 20/69 (28%), Positives = 38/69 (55%), Gaps = 1/69 (1%)
 Frame = +3

Query: 309 FRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFLIKIRPP 488
           F+  D D    + KEE    +KE G+  ++   +++ ++ DTD+ G I+ +EF   +R  
Sbjct: 413 FQHFDKDNDGHITKEELEMAMKEHGVG-DEVSIKQIITEVDTDNDGKINFEEFRTMMRSG 471

Query: 489 MS-ESRRKL 512
            S + +R+L
Sbjct: 472 SSLQPQREL 480


>At4g09570.1 68417.m01575 calcium-dependent protein kinase, putative
           / CDPK, putative similar to calcium-dependent protein
           kinase [Arabidopsis thaliana] gi|604881|dbj|BAA04830;
           contains protein kinase domain, Pfam:PF00069; contains
           EF hand domain (calcium-binding EF-hand), Pfam:PF00036,
           INTERPRO:IPR002048
          Length = 501

 Score = 48.4 bits (110), Expect = 4e-06
 Identities = 24/59 (40%), Positives = 33/59 (55%)
 Frame = +3

Query: 294 GLGRIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFL 470
           GL  +F+ +D D S  +  EE   G+K  G EL +SE + L    D D+SG+I   EFL
Sbjct: 330 GLKELFKMIDTDNSGTITFEELKAGLKRVGSELMESEIKSLMDAADIDNSGTIDYGEFL 388



 Score = 31.5 bits (68), Expect = 0.44
 Identities = 22/52 (42%), Positives = 27/52 (51%), Gaps = 4/52 (7%)
 Frame = +3

Query: 321 DDDGSKLLNKEEFLYGIKETGLELNKSEAEE----LFSQFDTDSSGSISLDE 464
           D D S  ++  EFL       L +NK E EE     FS FD D SG I++DE
Sbjct: 375 DIDNSGTIDYGEFLAAT----LHINKMEREENLVVAFSYFDKDGSGYITIDE 422



 Score = 27.5 bits (58), Expect = 7.2
 Identities = 12/30 (40%), Positives = 19/30 (63%)
 Frame = +3

Query: 408 EELFSQFDTDSSGSISLDEFLIKIRPPMSE 497
           +ELF   DTD+SG+I+ +E    ++   SE
Sbjct: 332 KELFKMIDTDNSGTITFEELKAGLKRVGSE 361


>At3g10660.1 68416.m01282 calcium-dependent protein kinase isoform 2
           (CPK2) identical to calcium-dependent protein kinase
           isoform 2 [Arabidopsis thaliana] gi|9837343|gb|AAG00535;
           contains protein kinase domain, Pfam:PF00069; contains
           EF hand domain (calcium-binding EF-hand), Pfam:PF00036,
           INTERPRO:IPR002048
          Length = 646

 Score = 48.4 bits (110), Expect = 4e-06
 Identities = 25/72 (34%), Positives = 38/72 (52%)
 Frame = +3

Query: 255 RLLCLSRGASGILGLGRIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDT 434
           R++  S     I GL ++F+ +D D S  +  EE   G+K  G  L +SE  +L    D 
Sbjct: 478 RVIAESLSEEEIAGLKQMFKMIDADNSGQITFEELKAGLKRVGANLKESEILDLMQAADV 537

Query: 435 DSSGSISLDEFL 470
           D+SG+I   EF+
Sbjct: 538 DNSGTIDYKEFI 549



 Score = 29.1 bits (62), Expect = 2.4
 Identities = 16/54 (29%), Positives = 24/54 (44%)
 Frame = +3

Query: 309 FRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFL 470
           F   D D S  +  +E     +E G+E   +  EE+    D D  G I  +EF+
Sbjct: 568 FSYFDKDESGFITPDELQQACEEFGVE--DARIEEMMRDVDQDKDGRIDYNEFV 619


>At1g35670.1 68414.m04435 calcium-dependent protein kinase 2 (CDPK2)
           identical to calcium-dependent protein kinase
           [Arabidopsis thaliana] gi|604881|dbj|BAA04830; contains
           protein kinase domain, Pfam:PF00069; contains EF hand
           domain (calcium-binding EF-hand), Pfam:PF00036,
           INTERPRO:IPR002048
          Length = 495

 Score = 48.4 bits (110), Expect = 4e-06
 Identities = 24/59 (40%), Positives = 33/59 (55%)
 Frame = +3

Query: 294 GLGRIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFL 470
           GL  +F+ +D D S  +  EE   G+K  G EL +SE + L    D D+SG+I   EFL
Sbjct: 331 GLKELFKMIDTDNSGTITFEELKAGLKRVGSELMESEIKSLMDAADIDNSGTIDYGEFL 389



 Score = 31.5 bits (68), Expect = 0.44
 Identities = 22/52 (42%), Positives = 27/52 (51%), Gaps = 4/52 (7%)
 Frame = +3

Query: 321 DDDGSKLLNKEEFLYGIKETGLELNKSEAEE----LFSQFDTDSSGSISLDE 464
           D D S  ++  EFL       L +NK E EE     FS FD D SG I++DE
Sbjct: 376 DIDNSGTIDYGEFLAAT----LHMNKMEREENLVAAFSYFDKDGSGYITIDE 423



 Score = 27.5 bits (58), Expect = 7.2
 Identities = 12/30 (40%), Positives = 19/30 (63%)
 Frame = +3

Query: 408 EELFSQFDTDSSGSISLDEFLIKIRPPMSE 497
           +ELF   DTD+SG+I+ +E    ++   SE
Sbjct: 333 KELFKMIDTDNSGTITFEELKAGLKRVGSE 362


>At5g19360.1 68418.m02307 calcium-dependent protein kinase, putative
           / CDPK, putative similar to calcium-dependent protein
           kinase [Marchantia polymorpha] gi|5162877|dbj|BAA81748
          Length = 523

 Score = 47.6 bits (108), Expect = 6e-06
 Identities = 24/69 (34%), Positives = 37/69 (53%)
 Frame = +3

Query: 264 CLSRGASGILGLGRIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSS 443
           CLS     I+GL  +F+ MD D S  +  EE   G+ + G  L++ E ++L    D D +
Sbjct: 365 CLSE--EEIMGLKEMFKGMDTDNSGTITLEELRQGLAKQGTRLSEYEVQQLMEAADADGN 422

Query: 444 GSISLDEFL 470
           G+I   EF+
Sbjct: 423 GTIDYGEFI 431


>At5g12180.1 68418.m01429 calcium-dependent protein kinase, putative
           / CDPK, putative
          Length = 528

 Score = 47.6 bits (108), Expect = 6e-06
 Identities = 24/69 (34%), Positives = 37/69 (53%)
 Frame = +3

Query: 264 CLSRGASGILGLGRIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSS 443
           CLS     I+GL  +F+ MD D S  +  EE   G+ + G  L++ E ++L    D D +
Sbjct: 370 CLSE--EEIMGLKEMFKGMDTDSSGTITLEELRQGLAKQGTRLSEYEVQQLMEAADADGN 427

Query: 444 GSISLDEFL 470
           G+I   EF+
Sbjct: 428 GTIDYGEFI 436


>At5g04870.1 68418.m00510 calcium-dependent protein kinase isoform
           AK1 (AK1) identical to calcium-dependent protein kinase,
           isoform AK1 (CDPK) [Arabidopsis thaliana]
           SWISS-PROT:Q06850; contains protein kinase domain,
           Pfam:PF00069; contains EF hand domain (calcium-binding
           EF-hand), Pfam:PF00036, INTERPRO:IPR002048
          Length = 610

 Score = 46.4 bits (105), Expect = 1e-05
 Identities = 25/72 (34%), Positives = 36/72 (50%)
 Frame = +3

Query: 255 RLLCLSRGASGILGLGRIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDT 434
           R++  S     I GL  +F  +D D S  +  EE   G+K  G  L +SE  +L    D 
Sbjct: 442 RVIAESLSEEEIAGLKEMFNMIDADKSGQITFEELKAGLKRVGANLKESEILDLMQAADV 501

Query: 435 DSSGSISLDEFL 470
           D+SG+I   EF+
Sbjct: 502 DNSGTIDYKEFI 513



 Score = 31.9 bits (69), Expect = 0.33
 Identities = 18/54 (33%), Positives = 25/54 (46%)
 Frame = +3

Query: 309 FRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFL 470
           F   D DGS  +  +E     +E G+E      EEL    D D+ G I  +EF+
Sbjct: 532 FTYFDKDGSGYITPDELQQACEEFGVE--DVRIEELMRDVDQDNDGRIDYNEFV 583


>At4g04710.1 68417.m00692 calcium-dependent protein kinase, putative
           / CDPK, putative similar to calcium-dependent protein
           kinase [Nicotiana tabacum] gi|3283996|gb|AAC25423;
           contains protein kinase domain, Pfam:PF00069; contains
           EF hand domain (calcium-binding EF-hand), Pfam:PF00036,
           INTERPRO:IPR002048
          Length = 575

 Score = 46.4 bits (105), Expect = 1e-05
 Identities = 28/90 (31%), Positives = 50/90 (55%)
 Frame = +3

Query: 297 LGRIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFLIK 476
           L + F+  D DGS  + KEE    +KE G+  +++ A++L S+FD ++ G I  +EF   
Sbjct: 411 LYKAFQYFDKDGSGHITKEEVEIAMKEHGMG-DEANAKDLISEFDKNNDGKIDYEEFCTM 469

Query: 477 IRPPMSESRRKL*NKHSRSLTRLVTVQSQL 566
           +R  + + + KL  +   +L  L T  ++L
Sbjct: 470 MRNGILQPQGKLLKRLYMNLEELKTGLTRL 499


>At5g23580.1 68418.m02767 calcium-dependent protein kinase 9 (CDPK9)
           identical to calcium-dependent protein kinase
           [Arabidopsis thaliana] gi|836938|gb|AAA67653; contains
           protein kinase domain, Pfam:PF00069; contains EF hand
           domain (calcium-binding EF-hand), Pfam:PF00036,
           INTERPRO:IPR002048
          Length = 490

 Score = 45.2 bits (102), Expect = 3e-05
 Identities = 23/59 (38%), Positives = 32/59 (54%)
 Frame = +3

Query: 294 GLGRIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFL 470
           GL  +F+ +D D S  +  EE    ++  G EL +SE +EL    D D SG+I   EFL
Sbjct: 327 GLKELFKMIDTDKSGTITFEELKDSMRRVGSELMESEIQELLRAADVDESGTIDYGEFL 385



 Score = 27.9 bits (59), Expect = 5.4
 Identities = 13/30 (43%), Positives = 18/30 (60%)
 Frame = +3

Query: 408 EELFSQFDTDSSGSISLDEFLIKIRPPMSE 497
           +ELF   DTD SG+I+ +E    +R   SE
Sbjct: 329 KELFKMIDTDKSGTITFEELKDSMRRVGSE 358


>At4g35310.1 68417.m05019 calcium-dependent protein kinase, putative
           / CDPK, putative similar to calmodulin-domain protein
           kinase CDPK isoform 6 [Arabidopsis thaliana]
           gi|1399275|gb|AAB03246; contains protein kinase domain,
           Pfam:PF00069; contains EF hand domain (calcium-binding
           EF-hand), Pfam:PF00036, INTERPRO:IPR002048
          Length = 556

 Score = 44.8 bits (101), Expect = 4e-05
 Identities = 22/72 (30%), Positives = 37/72 (51%)
 Frame = +3

Query: 255 RLLCLSRGASGILGLGRIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDT 434
           +++  S     I GL  +F+ MD D S  +  +E   G+++ G  L  +E  +L    D 
Sbjct: 389 KVIAESLSEEEIAGLREMFQAMDTDNSGAITFDELKAGLRKYGSTLKDTEIHDLMDAADV 448

Query: 435 DSSGSISLDEFL 470
           D+SG+I   EF+
Sbjct: 449 DNSGTIDYSEFI 460



 Score = 29.5 bits (63), Expect = 1.8
 Identities = 20/52 (38%), Positives = 26/52 (50%), Gaps = 4/52 (7%)
 Frame = +3

Query: 321 DDDGSKLLNKEEFLYGIKETGLELNKSEAEE----LFSQFDTDSSGSISLDE 464
           D D S  ++  EF+       + LNK E EE     F  FD D SG I++DE
Sbjct: 447 DVDNSGTIDYSEFIAAT----IHLNKLEREEHLVAAFQYFDKDGSGFITIDE 494



 Score = 28.3 bits (60), Expect = 4.1
 Identities = 16/45 (35%), Positives = 24/45 (53%)
 Frame = +3

Query: 348 KEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFLIKIR 482
           K+  L  I E+  E   +   E+F   DTD+SG+I+ DE    +R
Sbjct: 384 KKMALKVIAESLSEEEIAGLREMFQAMDTDNSGAITFDELKAGLR 428


>At4g23650.1 68417.m03405 calcium-dependent protein kinase, putative
           / CDPK, putative similar to calcium-dependent protein
           kinase [Marchantia polymorpha] gi|5162877|dbj|BAA81748;
           contains protein kinase domain, Pfam:PF00069; contains
           EF hand domain (calcium-binding EF-hand), Pfam:PF00036,
           INTERPRO:IPR002048
          Length = 529

 Score = 43.6 bits (98), Expect = 1e-04
 Identities = 19/61 (31%), Positives = 35/61 (57%)
 Frame = +3

Query: 288 ILGLGRIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEF 467
           I+GL  +F+ +D D + ++  EE   G+ + G +++++E  +L    D D  GSI   EF
Sbjct: 381 IIGLKEMFKSLDTDNNGIVTLEELRTGLPKLGSKISEAEIRQLMEAADMDGDGSIDYLEF 440

Query: 468 L 470
           +
Sbjct: 441 I 441



 Score = 36.3 bits (80), Expect = 0.016
 Identities = 20/71 (28%), Positives = 40/71 (56%), Gaps = 3/71 (4%)
 Frame = +3

Query: 309 FRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFLIKIR-- 482
           F+  D+D S  +  EE    +K+  +  +KS  +E+ ++ DTD  G I+ +EF+  ++  
Sbjct: 460 FQFFDNDNSGYITMEELELAMKKYNMGDDKS-IKEIIAEVDTDRDGKINYEEFVAMMKKG 518

Query: 483 -PPMSESRRKL 512
            P +  +RR++
Sbjct: 519 NPELVPNRRRM 529


>At2g17290.1 68415.m01997 calcium-dependent protein kinase isoform 6
           (CPK6) identical to calmodulin-domain protein kinase
           CDPK isoform 6 [Arabidopsis thaliana]
           gi|1399275|gb|AAB03246; contains protein kinase domain,
           Pfam:PF00069; contains EF hand domain (calcium-binding
           EF-hand), Pfam:PF00036, INTERPRO:IPR002048
          Length = 544

 Score = 43.6 bits (98), Expect = 1e-04
 Identities = 22/72 (30%), Positives = 35/72 (48%)
 Frame = +3

Query: 255 RLLCLSRGASGILGLGRIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDT 434
           +++  S     I GL  +F  MD D S  +  +E   G++  G  L  +E  +L    D 
Sbjct: 377 KVIAESLSEEEIAGLRAMFEAMDTDNSGAITFDELKAGLRRYGSTLKDTEIRDLMEAADV 436

Query: 435 DSSGSISLDEFL 470
           D+SG+I   EF+
Sbjct: 437 DNSGTIDYSEFI 448



 Score = 29.5 bits (63), Expect = 1.8
 Identities = 20/52 (38%), Positives = 26/52 (50%), Gaps = 4/52 (7%)
 Frame = +3

Query: 321 DDDGSKLLNKEEFLYGIKETGLELNKSEAEE----LFSQFDTDSSGSISLDE 464
           D D S  ++  EF+       + LNK E EE     F  FD D SG I++DE
Sbjct: 435 DVDNSGTIDYSEFIAAT----IHLNKLEREEHLVSAFQYFDKDGSGYITIDE 482


>At1g76040.2 68414.m08829 calcium-dependent protein kinase, putative
           / CDPK, putative similar to calcium-dependent protein
           kinase GB:AAC25423 GI:3283996 [Nicotiana tabacum]
          Length = 534

 Score = 43.6 bits (98), Expect = 1e-04
 Identities = 22/61 (36%), Positives = 33/61 (54%)
 Frame = +3

Query: 288 ILGLGRIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEF 467
           I GL + F+ MD D S  +  +E   G+   G +L +SE ++L    D D SG+I   EF
Sbjct: 387 IKGLKQTFKNMDTDESGTITFDELRNGLHRLGSKLTESEIKQLMEAADVDKSGTIDYIEF 446

Query: 468 L 470
           +
Sbjct: 447 V 447



 Score = 38.7 bits (86), Expect = 0.003
 Identities = 19/68 (27%), Positives = 38/68 (55%)
 Frame = +3

Query: 309 FRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFLIKIRPP 488
           F+  D D S  + ++E  + + E G+  + +  +E+ +  DTD+ G I+ +EF+  +R  
Sbjct: 466 FKYFDKDRSGFITRDELKHSMTEYGMG-DDATIDEVINDVDTDNDGRINYEEFVAMMRKG 524

Query: 489 MSESRRKL 512
            ++S  KL
Sbjct: 525 TTDSDPKL 532


>At1g76040.1 68414.m08830 calcium-dependent protein kinase, putative
           / CDPK, putative similar to calcium-dependent protein
           kinase GB:AAC25423 GI:3283996 [Nicotiana tabacum]
          Length = 323

 Score = 43.6 bits (98), Expect = 1e-04
 Identities = 22/61 (36%), Positives = 33/61 (54%)
 Frame = +3

Query: 288 ILGLGRIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEF 467
           I GL + F+ MD D S  +  +E   G+   G +L +SE ++L    D D SG+I   EF
Sbjct: 176 IKGLKQTFKNMDTDESGTITFDELRNGLHRLGSKLTESEIKQLMEAADVDKSGTIDYIEF 235

Query: 468 L 470
           +
Sbjct: 236 V 236



 Score = 38.7 bits (86), Expect = 0.003
 Identities = 19/68 (27%), Positives = 38/68 (55%)
 Frame = +3

Query: 309 FRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFLIKIRPP 488
           F+  D D S  + ++E  + + E G+  + +  +E+ +  DTD+ G I+ +EF+  +R  
Sbjct: 255 FKYFDKDRSGFITRDELKHSMTEYGMG-DDATIDEVINDVDTDNDGRINYEEFVAMMRKG 313

Query: 489 MSESRRKL 512
            ++S  KL
Sbjct: 314 TTDSDPKL 321


>At4g21940.1 68417.m03174 calcium-dependent protein kinase, putative
           / CDPK, putative similar to calcium-dependent protein
           kinase [Nicotiana tabacum] gi|3283996|gb|AAC25423
          Length = 554

 Score = 43.2 bits (97), Expect = 1e-04
 Identities = 22/72 (30%), Positives = 37/72 (51%)
 Frame = +3

Query: 255 RLLCLSRGASGILGLGRIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDT 434
           +++  S     I GL  +F  MD D S  +  EE   G+ + G +L ++E ++L    D 
Sbjct: 393 KVIAESLSEEEIKGLKTMFANMDTDKSGTITYEELKNGLAKLGSKLTEAEVKQLMEAADV 452

Query: 435 DSSGSISLDEFL 470
           D +G+I   EF+
Sbjct: 453 DGNGTIDYIEFI 464



 Score = 36.3 bits (80), Expect = 0.016
 Identities = 17/60 (28%), Positives = 34/60 (56%)
 Frame = +3

Query: 303 RIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFLIKIR 482
           + F+  D D S  +  +E    +KE G+  +++  +E+ ++ DTD+ G I+ +EF   +R
Sbjct: 481 KAFQYFDKDNSGFITMDELESAMKEYGMG-DEASIKEVIAEVDTDNDGRINYEEFCAMMR 539


>At3g51920.1 68416.m05695 calmodulin-9 (CAM9) identical to
           calmodulin 9 GI:5825602 from [Arabidopsis thaliana];
           contains Pfam profile PF00036: EF hand
          Length = 151

 Score = 43.2 bits (97), Expect = 1e-04
 Identities = 19/54 (35%), Positives = 31/54 (57%)
 Frame = +3

Query: 306 IFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEF 467
           +FR  D DG  L+++ E   G+K+ G+++   EAE +  + D D  G +S  EF
Sbjct: 89  VFRVFDRDGDGLISQLELGEGMKDMGMKITAEEAEHMVREADLDGDGFLSFHEF 142


>At3g20410.1 68416.m02585 calmodulin-domain protein kinase isoform 9
           (CPK9) identical to calmodulin-domain protein kinase
           CDPK isoform 9 [Arabidopsis thaliana]
           gi|1399265|gb|AAB03242
          Length = 541

 Score = 43.2 bits (97), Expect = 1e-04
 Identities = 21/61 (34%), Positives = 33/61 (54%)
 Frame = +3

Query: 288 ILGLGRIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEF 467
           I GL  +F  +D D S  +  EE   G+ + G +L ++E ++L    D D +GSI   EF
Sbjct: 394 IQGLKAMFANIDTDNSGTITYEELKEGLAKLGSKLTEAEVKQLMDAADVDGNGSIDYIEF 453

Query: 468 L 470
           +
Sbjct: 454 I 454



 Score = 34.3 bits (75), Expect = 0.063
 Identities = 18/62 (29%), Positives = 33/62 (53%)
 Frame = +3

Query: 297 LGRIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFLIK 476
           L + F+  D D S  +  +E    +KE G+  + +  +E+ S  D+D+ G I+ +EF   
Sbjct: 469 LYKAFQHFDKDSSGYITIDELESALKEYGMG-DDATIKEVLSDVDSDNDGRINYEEFCAM 527

Query: 477 IR 482
           +R
Sbjct: 528 MR 529



 Score = 28.3 bits (60), Expect = 4.1
 Identities = 18/49 (36%), Positives = 28/49 (57%), Gaps = 1/49 (2%)
 Frame = +3

Query: 321 DDDGSKLLNKEEFLYG-IKETGLELNKSEAEELFSQFDTDSSGSISLDE 464
           D DG+  ++  EF+   +    LE N++   + F  FD DSSG I++DE
Sbjct: 441 DVDGNGSIDYIEFITATMHRHRLESNEN-LYKAFQHFDKDSSGYITIDE 488


>At4g37010.1 68417.m05243 caltractin, putative / centrin, putative
           similar to Caltractin (Centrin) SP:P41210 from [Atriplex
           nummularia]
          Length = 167

 Score = 42.7 bits (96), Expect = 2e-04
 Identities = 19/55 (34%), Positives = 30/55 (54%)
 Frame = +3

Query: 306 IFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFL 470
           IF   D DGS  ++  E    ++  G E+N  +  EL ++ D + SG+I  DEF+
Sbjct: 31  IFDLFDIDGSGSIDASELNVAMRSLGFEMNNQQINELMAEVDKNQSGAIDFDEFV 85



 Score = 36.3 bits (80), Expect = 0.016
 Identities = 15/58 (25%), Positives = 30/58 (51%)
 Frame = +3

Query: 297 LGRIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFL 470
           L + F+ +D D +  ++  +     KE G     ++ EE+  + D D  G ++L+EF+
Sbjct: 101 LSKAFKIIDHDNNGKISPRDIKMIAKELGENFTDNDIEEMIEEADRDKDGEVNLEEFM 158



 Score = 28.3 bits (60), Expect = 4.1
 Identities = 12/29 (41%), Positives = 16/29 (55%)
 Frame = +3

Query: 396 KSEAEELFSQFDTDSSGSISLDEFLIKIR 482
           + E  E+F  FD D SGSI   E  + +R
Sbjct: 25  RREIREIFDLFDIDGSGSIDASELNVAMR 53


>At1g50700.1 68414.m05701 calcium-dependent protein kinase, putative
           / CDPK, putative similar to calmodulin-domain protein
           kinase CDPK isoform 9 [Arabidopsis thaliana]
           gi|1399265|gb|AAB03242
          Length = 521

 Score = 42.7 bits (96), Expect = 2e-04
 Identities = 21/61 (34%), Positives = 32/61 (52%)
 Frame = +3

Query: 288 ILGLGRIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEF 467
           I GL  +F  +D D S  +  EE   G+ + G  L ++E ++L    D D +GSI   EF
Sbjct: 376 IQGLKAMFANIDTDNSGTITYEELKEGLAKLGSRLTEAEVKQLMDAADVDGNGSIDYIEF 435

Query: 468 L 470
           +
Sbjct: 436 I 436



 Score = 38.7 bits (86), Expect = 0.003
 Identities = 19/60 (31%), Positives = 32/60 (53%)
 Frame = +3

Query: 303 RIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFLIKIR 482
           + F+  D DGS  +  +E    +KE G+  + +  +E+ S  D D+ G I+ DEF   +R
Sbjct: 453 KAFQHFDKDGSGYITTDELEAALKEYGMG-DDATIKEILSDVDADNDGRINYDEFCAMMR 511


>At1g61950.1 68414.m06988 calcium-dependent protein kinase, putative
           / CDPK, putative similar to calcium-dependent protein
           kinase GI:3283996 from [Nicotiana tabacum]; contains
           protein kinase domain, Pfam:PF00069; contains EF hand
           domain (calcium-binding EF-hand), Pfam:PF00036,
           INTERPRO:IPR002048
          Length = 551

 Score = 41.5 bits (93), Expect = 4e-04
 Identities = 19/59 (32%), Positives = 32/59 (54%)
 Frame = +3

Query: 294 GLGRIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFL 470
           GL  +F  MD D S  +  +E   G+++ G  L ++E ++L    D D +G+I   EF+
Sbjct: 404 GLKTMFANMDTDKSGTITYDELKSGLEKLGSRLTETEVKQLLEDADVDGNGTIDYIEFI 462



 Score = 33.9 bits (74), Expect = 0.083
 Identities = 19/72 (26%), Positives = 36/72 (50%)
 Frame = +3

Query: 297 LGRIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFLIK 476
           L + F+  D D S  ++++E    +KE  +  +    +E+ S+ D D+ GSI+  EF   
Sbjct: 477 LFKAFQHFDKDNSGFISRQELETAMKEYNMG-DDIMIKEIISEVDADNDGSINYQEFCNM 535

Query: 477 IRPPMSESRRKL 512
           ++      + KL
Sbjct: 536 MKSCSQSHQSKL 547


>At4g04720.1 68417.m00693 calcium-dependent protein kinase, putative
           / CDPK, putative similar to calcium-dependent protein
           kinase(CDPK) [Carrot] SWISS-PROT:P28582
          Length = 531

 Score = 41.1 bits (92), Expect = 5e-04
 Identities = 21/72 (29%), Positives = 36/72 (50%)
 Frame = +3

Query: 255 RLLCLSRGASGILGLGRIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDT 434
           +++  S     I GL  +F  +D D S  +  EE   G+   G  L+++E ++L    D 
Sbjct: 371 KVIAESLSEEEIKGLKTMFANIDTDKSGTITYEELKTGLTRLGSRLSETEVKQLMEAADV 430

Query: 435 DSSGSISLDEFL 470
           D +G+I   EF+
Sbjct: 431 DGNGTIDYYEFI 442



 Score = 41.1 bits (92), Expect = 5e-04
 Identities = 20/70 (28%), Positives = 40/70 (57%)
 Frame = +3

Query: 303 RIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFLIKIR 482
           + F+  D D S  + ++E    +KE G+  +++  +E+ S+ DTD+ G I+ +EF   +R
Sbjct: 459 KAFQHFDKDNSGHITRDELESAMKEYGMG-DEASIKEVISEVDTDNDGRINFEEFCAMMR 517

Query: 483 PPMSESRRKL 512
              ++ + KL
Sbjct: 518 SGSTQPQGKL 527


>At2g31500.1 68415.m03848 calcium-dependent protein kinase, putative
           / CDPK, putative similar to calcium-dependent protein
           kinase [Arabidopsis thaliana] gi|836942|gb|AAA67655;
           contains protein kinase domain, Pfam:PF00069; contains
           EF hand domain (calcium-binding EF-hand), Pfam:PF00036,
           INTERPRO:IPR002048
          Length = 582

 Score = 39.1 bits (87), Expect = 0.002
 Identities = 20/61 (32%), Positives = 33/61 (54%)
 Frame = +3

Query: 288 ILGLGRIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEF 467
           I  + ++F+ MD D +  L  EE   G+K+ G  +   + + L    DTD +G +S DEF
Sbjct: 369 IAAIVQMFQTMDTDKNGHLTFEELRDGLKKIGQVVPDGDVKMLMDAADTDGNGMLSCDEF 428

Query: 468 L 470
           +
Sbjct: 429 V 429



 Score = 29.1 bits (62), Expect = 2.4
 Identities = 18/56 (32%), Positives = 30/56 (53%), Gaps = 3/56 (5%)
 Frame = +3

Query: 321 DDDGSKLLNKEEFL---YGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFLIKI 479
           D DG+ +L+ +EF+     +K  G + +  EA   F  FD + +G I LDE  + +
Sbjct: 416 DTDGNGMLSCDEFVTLSIHLKRMGCDEHLQEA---FKYFDKNGNGFIELDELKVAL 468



 Score = 28.7 bits (61), Expect = 3.1
 Identities = 11/25 (44%), Positives = 18/25 (72%)
 Frame = +2

Query: 512 VEQAFKKLDKTGDGAITIDDIKGCL 586
           +++AFK  DK G+G I +D++K  L
Sbjct: 444 LQEAFKYFDKNGNGFIELDELKVAL 468


>At4g04740.1 68417.m00695 calcium-dependent protein kinase, putative
           / CDPK, putative similar to calcium-dependent protein
           kinase [Lycopersicon esculentum]
           gi|19171502|emb|CAC87494
          Length = 520

 Score = 37.9 bits (84), Expect = 0.005
 Identities = 18/69 (26%), Positives = 40/69 (57%)
 Frame = +3

Query: 303 RIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFLIKIR 482
           + F+ +D D +  + ++E    +KE G+  +++  +E+ S+ DTD+ G I+ +EF   +R
Sbjct: 448 KAFQHLDKDKNGHITRDELESAMKEYGMG-DEASIKEVISEVDTDNDGKINFEEFRAMMR 506

Query: 483 PPMSESRRK 509
              ++ + K
Sbjct: 507 CGTTQPKGK 515



 Score = 37.1 bits (82), Expect = 0.009
 Identities = 19/72 (26%), Positives = 35/72 (48%)
 Frame = +3

Query: 255 RLLCLSRGASGILGLGRIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDT 434
           ++  +S     I GL  +F  MD + S  +  E+   G+      L+++E ++L    D 
Sbjct: 360 KVSAVSLSEEEIKGLKTLFANMDTNRSGTITYEQLQTGLSRLRSRLSETEVQQLVEASDV 419

Query: 435 DSSGSISLDEFL 470
           D +G+I   EF+
Sbjct: 420 DGNGTIDYYEFI 431


>At3g17470.1 68416.m02232 RelA/SpoT domain-containing protein /
           calcium-binding EF-hand family protein contains
           INTERPRO:IPR002048 calcium-binding EF-hand domain, Pfam
           profile PF04607: Region found in RelA / SpoT proteins
          Length = 583

 Score = 37.9 bits (84), Expect = 0.005
 Identities = 19/55 (34%), Positives = 33/55 (60%)
 Frame = +3

Query: 303 RIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEF 467
           R+F  +D +G  +++ EE +  ++E G      +AEE+    D++S GS+S DEF
Sbjct: 477 RVFCLLDKNGDGMISIEELMEVMEELGAP--GEDAEEMMQLLDSNSDGSLSSDEF 529


>At5g12480.1 68418.m01466 calmodulin-domain protein kinase isoform 7
           (CPK7) identical to calmodulin-domain protein kinase
           CDPK isoform 7 [Arabidopsis thaliana]
           gi|1399277|gb|AAB03247
          Length = 535

 Score = 37.5 bits (83), Expect = 0.007
 Identities = 16/59 (27%), Positives = 31/59 (52%)
 Frame = +3

Query: 294 GLGRIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFL 470
           G+   F  MD +    +N EE  YG+++ G ++  ++ + L    D D  G+++  EF+
Sbjct: 364 GIKEAFEMMDVNKRGKINLEELKYGLQKAGQQIADTDLQILMEATDVDGDGTLNYSEFV 422


>At3g51850.1 68416.m05686 calcium-dependent protein kinase, putative
           / CDPK, putative similar to calcium-dependent protein
           kinase [Arabidopsis thaliana] gi|836942|gb|AAA67655;
           contains protein kinase domain, Pfam:PF00069; contains
           EF hand domain (calcium-binding EF-hand), Pfam:PF00036,
           INTERPRO:IPR002048
          Length = 528

 Score = 37.5 bits (83), Expect = 0.007
 Identities = 19/57 (33%), Positives = 29/57 (50%)
 Frame = +3

Query: 297 LGRIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEF 467
           L + F   D DG+  +  +E    +KE G +     A ++F + DTD  G IS +EF
Sbjct: 432 LRKAFSYFDKDGNGYILPQELCDALKEDGGDDCVDVANDIFQEVDTDKDGRISYEEF 488


>At3g24110.1 68416.m03027 calcium-binding EF hand family protein
           contains Pfam profile: PF00036 EF hand, similar to
           calcium-modulated proteins
          Length = 229

 Score = 37.5 bits (83), Expect = 0.007
 Identities = 18/63 (28%), Positives = 33/63 (52%)
 Frame = +3

Query: 285 GILGLGRIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDE 464
           G+  +  +F   D+D +  ++ EE    ++E  L L+  E + L+S  D D S  I  +E
Sbjct: 54  GLRNIRSVFESYDNDTNGTIDIEELKKCLEELKLSLSDEEVKGLYSWCDVDGSKGIQFNE 113

Query: 465 FLI 473
           F++
Sbjct: 114 FIV 116


>At5g37770.1 68418.m04547 touch-responsive protein /
           calmodulin-related protein 2, touch-induced (TCH2)
           identical to calmodulin-related protein 2,touch-induced
           SP:P25070 from [Arabidopsis thaliana]
          Length = 161

 Score = 37.1 bits (82), Expect = 0.009
 Identities = 17/56 (30%), Positives = 29/56 (51%)
 Frame = +3

Query: 303 RIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFL 470
           ++F+R D +G   ++ +E    I+      +  E   +  QFD D +G I LDEF+
Sbjct: 20  KVFQRFDKNGDGKISVDELKEVIRALSPTASPEETVTMMKQFDLDGNGFIDLDEFV 75


>At2g41100.2 68415.m05077 touch-responsive protein /
           calmodulin-related protein 3, touch-induced (TCH3)
           identical to calmodulin-related protein 3, touch-induced
           SP:P25071 from [Arabidopsis thaliana]
          Length = 235

 Score = 37.1 bits (82), Expect = 0.009
 Identities = 19/74 (25%), Positives = 35/74 (47%)
 Frame = +3

Query: 288 ILGLGRIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEF 467
           IL     FR  D +G   +   E    ++  G    K+E +++ ++ D D  G+IS  EF
Sbjct: 100 ILEFREAFRVFDKNGDGYITVNELRTTMRSLGETQTKAELQDMINEADADGDGTISFSEF 159

Query: 468 LIKIRPPMSESRRK 509
           +  +   M +++ K
Sbjct: 160 VCVMTGKMIDTQSK 173



 Score = 27.5 bits (58), Expect = 7.2
 Identities = 9/20 (45%), Positives = 16/20 (80%)
 Frame = +2

Query: 518 QAFKKLDKTGDGAITIDDIK 577
           +AF+  DK GDG IT+++++
Sbjct: 105 EAFRVFDKNGDGYITVNELR 124


>At2g41100.1 68415.m05076 touch-responsive protein /
           calmodulin-related protein 3, touch-induced (TCH3)
           identical to calmodulin-related protein 3, touch-induced
           SP:P25071 from [Arabidopsis thaliana]
          Length = 324

 Score = 37.1 bits (82), Expect = 0.009
 Identities = 19/74 (25%), Positives = 35/74 (47%)
 Frame = +3

Query: 288 ILGLGRIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEF 467
           IL     FR  D +G   +   E    ++  G    K+E +++ ++ D D  G+IS  EF
Sbjct: 189 ILEFREAFRVFDKNGDGYITVNELRTTMRSLGETQTKAELQDMINEADADGDGTISFSEF 248

Query: 468 LIKIRPPMSESRRK 509
           +  +   M +++ K
Sbjct: 249 VCVMTGKMIDTQSK 262



 Score = 27.5 bits (58), Expect = 7.2
 Identities = 9/20 (45%), Positives = 16/20 (80%)
 Frame = +2

Query: 518 QAFKKLDKTGDGAITIDDIK 577
           +AF+  DK GDG IT+++++
Sbjct: 194 EAFRVFDKNGDGYITVNELR 213


>At4g03290.1 68417.m00449 calcium-binding protein, putative similar
           to calcium-binding protein [Lotus japonicus]
           GI:18413495; contains INTERPRO:IPR002048 calcium-binding
           EF-hand domain
          Length = 154

 Score = 36.7 bits (81), Expect = 0.012
 Identities = 14/57 (24%), Positives = 28/57 (49%)
 Frame = +3

Query: 297 LGRIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEF 467
           L R+F+  D DG   +  +E     K  G+ + + E  ++  + D +  G + ++EF
Sbjct: 6   LNRVFQMFDKDGDGKITTKELNESFKNLGIIIPEDELTQIIQKIDVNGDGCVDIEEF 62



 Score = 30.7 bits (66), Expect = 0.77
 Identities = 11/25 (44%), Positives = 18/25 (72%)
 Frame = +2

Query: 512 VEQAFKKLDKTGDGAITIDDIKGCL 586
           +++AF   D+ GDG IT+D++K  L
Sbjct: 82  MKEAFNVFDRNGDGFITVDELKAVL 106


>At2g43290.1 68415.m05382 calmodulin-like protein (MSS3) identical
           to calmodulin-like MSS3 from GI:9965747 [Arabidopsis
           thaliana]
          Length = 215

 Score = 36.3 bits (80), Expect = 0.016
 Identities = 14/57 (24%), Positives = 29/57 (50%)
 Frame = +3

Query: 297 LGRIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEF 467
           L R+F+  D +G   + KEE    ++  G+ +   +  ++  + D +  G + +DEF
Sbjct: 66  LKRVFQMFDKNGDGRITKEELNDSLENLGIYIPDKDLTQMIHKIDANGDGCVDIDEF 122



 Score = 29.1 bits (62), Expect = 2.4
 Identities = 16/56 (28%), Positives = 25/56 (44%), Gaps = 2/56 (3%)
 Frame = +3

Query: 309 FRRMDDDGSKLLNKEEFLYGIKETGLELNKS--EAEELFSQFDTDSSGSISLDEFL 470
           F   D DG   +  EE    +   GL+  K+    +++  Q D D  G ++  EFL
Sbjct: 148 FNVFDQDGDGFITVEELKSVMASLGLKQGKTLDGCKKMIMQVDADGDGRVNYKEFL 203


>At4g04700.1 68417.m00690 calcium-dependent protein kinase, putative
           / CDPK, putative similar to calcium-dependent protein
           kinase [Nicotiana tabacum] gi|3283996|gb|AAC25423;
           contains protein kinase domain, Pfam:PF00069
          Length = 485

 Score = 35.9 bits (79), Expect = 0.021
 Identities = 18/64 (28%), Positives = 32/64 (50%)
 Frame = +3

Query: 303 RIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFLIKIR 482
           + F+  D D    + KEE    +KE G   ++   +++ +  DTD+ G I+ +EF   +R
Sbjct: 411 KAFQHFDKDNDGHITKEELEMAMKEDGAG-DEGSIKQIIADADTDNDGKINFEEFRTMMR 469

Query: 483 PPMS 494
              S
Sbjct: 470 TESS 473


>At3g50770.1 68416.m05560 calmodulin-related protein, putative
           similar to regulator of gene silencing
           calmodulin-related protein GI:12963415 from [Nicotiana
           tabacum]
          Length = 205

 Score = 35.9 bits (79), Expect = 0.021
 Identities = 15/58 (25%), Positives = 30/58 (51%)
 Frame = +3

Query: 297 LGRIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFL 470
           L ++F   D DG   ++  E  +     G  ++   A+E  ++ DTD+ GS+  ++F+
Sbjct: 65  LRQVFSHFDSDGDGKISAFELRHYFGSVGEYISHEAAQEAINEVDTDADGSLGFEDFV 122


>At2g27030.3 68415.m03247 calmodulin-2/3/5 (CAM5) (TCH1) identical
           to calmodulin GI:474183 from [Arabidopsis thaliana],
           SP|P25069 Calmodulin-2/3/5 {Arabidopsis thaliana}
          Length = 181

 Score = 35.9 bits (79), Expect = 0.021
 Identities = 20/77 (25%), Positives = 35/77 (45%)
 Frame = +3

Query: 297 LGRIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFLIK 476
           L   FR  D D +  ++  E  + +   G +L   E +E+  + D D  G I+ +EF +K
Sbjct: 86  LKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIKEADVDGDGQINYEEF-VK 144

Query: 477 IRPPMSESRRKL*NKHS 527
           +       +R +  K S
Sbjct: 145 VMMAKRRGKRVMAAKRS 161



 Score = 32.3 bits (70), Expect = 0.25
 Identities = 14/54 (25%), Positives = 27/54 (50%)
 Frame = +3

Query: 309 FRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFL 470
           F   D DG   +  +E    ++  G    ++E +++ ++ D D +G+I   EFL
Sbjct: 17  FSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFL 70


>At1g32250.1 68414.m03967 calmodulin, putative similar to calmodulin
           GB:M59770 GI:160127 from (Plasmodium falciparum);
           contains INTERPRO:IPR002048 calcium-binding EF-hand
           domain
          Length = 166

 Score = 35.9 bits (79), Expect = 0.021
 Identities = 16/55 (29%), Positives = 27/55 (49%)
 Frame = +3

Query: 303 RIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEF 467
           R+FR  D DG+  +   E  + + + G  L  +E   +  + D+D  G I+  EF
Sbjct: 98  RLFRIFDTDGNGFITAAELAHSMAKLGHALTVAELTGMIKEADSDGDGRINFQEF 152


>At5g37780.1 68418.m04549 calmodulin-1/4 (CAM1) identical to
           calmodulin 4 [Arabidopsis thaliana] GI:16223, SP|P25854
           Calmodulin-1/4 {Arabidopsis thaliana}
          Length = 149

 Score = 35.5 bits (78), Expect = 0.027
 Identities = 17/58 (29%), Positives = 28/58 (48%)
 Frame = +3

Query: 297 LGRIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFL 470
           L   FR  D D +  ++  E  + +   G +L   E EE+  + D D  G I+ +EF+
Sbjct: 86  LKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVEEMIREADVDGDGQINYEEFV 143



 Score = 32.7 bits (71), Expect = 0.19
 Identities = 15/64 (23%), Positives = 31/64 (48%)
 Frame = +3

Query: 309 FRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFLIKIRPP 488
           F   D DG   +  +E    ++  G    ++E +++ ++ D D +G+I   EFL  +   
Sbjct: 17  FSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLNLMAKK 76

Query: 489 MSES 500
           M ++
Sbjct: 77  MKDT 80


>At2g41090.1 68415.m05075 calmodulin-like calcium-binding protein,
           22 kDa (CaBP-22) identical to SP|P30187 22 kDa
           calmodulin-like calcium-binding protein (CABP-22)
           [Arabidopsis thaliana]
          Length = 191

 Score = 35.5 bits (78), Expect = 0.027
 Identities = 18/54 (33%), Positives = 28/54 (51%)
 Frame = +3

Query: 309 FRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFL 470
           F   D +G   +  EEF   ++  GL L ++E +E  +  D D  G+I+  EFL
Sbjct: 17  FSVYDKNGDGHITTEEFGAVMRSLGLNLTQAELQEEINDSDLDGDGTINFTEFL 70


>At1g66410.1 68414.m07542 calmodulin-1/4 (CAM4) identical to
           calmodulin [Arabidopsis thaliana] GI:16223; nearly
           identical to SP|P25854 Calmodulin-1/4 {Arabidopsis
           thaliana}
          Length = 149

 Score = 35.5 bits (78), Expect = 0.027
 Identities = 17/58 (29%), Positives = 28/58 (48%)
 Frame = +3

Query: 297 LGRIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFL 470
           L   FR  D D +  ++  E  + +   G +L   E EE+  + D D  G I+ +EF+
Sbjct: 86  LKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVEEMIREADVDGDGQINYEEFV 143



 Score = 32.7 bits (71), Expect = 0.19
 Identities = 15/64 (23%), Positives = 31/64 (48%)
 Frame = +3

Query: 309 FRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFLIKIRPP 488
           F   D DG   +  +E    ++  G    ++E +++ ++ D D +G+I   EFL  +   
Sbjct: 17  FSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLNLMAKK 76

Query: 489 MSES 500
           M ++
Sbjct: 77  MKDT 80


>At1g74740.1 68414.m08660 calcium-dependent protein kinase, putative
           / CDPK, putative similar to calcium-dependent protein
           kinase [Arabidopsis thaliana] gi|604880|dbj|BAA04829;
           contains protein kinase domain, Pfam:PF00069; contains
           EF hand domain (calcium-binding EF-hand), Pfam:PF00036,
           INTERPRO:IPR002048
          Length = 541

 Score = 35.1 bits (77), Expect = 0.036
 Identities = 17/58 (29%), Positives = 29/58 (50%)
 Frame = +3

Query: 309 FRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFLIKIR 482
           F   D DGS  +  EE    + +   E + S   ++  + DTD  G I+ DEF++ ++
Sbjct: 441 FMFFDKDGSGYIESEELREALTDELGEPDNSVIIDIMREVDTDKDGKINYDEFVVMMK 498


>At1g18530.1 68414.m02312 calmodulin, putative similar to calmodulin
           GI:1565285 from [Toxoplasma gondii]
          Length = 157

 Score = 35.1 bits (77), Expect = 0.036
 Identities = 17/54 (31%), Positives = 26/54 (48%)
 Frame = +3

Query: 306 IFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEF 467
           IF+  D DG+  ++  E    + + G  L   E  E+  + DT+  G IS  EF
Sbjct: 86  IFKSFDRDGNGFISAAELAGAMAKMGQPLTYKELTEMIKEADTNGDGVISFGEF 139


>At5g21274.1 68418.m02533 calmodulin-6 (CAM6) identical to
           calmodulin-6 SP:Q03509 from [Arabidopsis thaliana];
           contains Pfam profile: PF00036 EF hand
          Length = 149

 Score = 34.7 bits (76), Expect = 0.047
 Identities = 16/58 (27%), Positives = 29/58 (50%)
 Frame = +3

Query: 297 LGRIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFL 470
           L   FR  D D +  ++  E  + +   G +L+  E +E+  + D D  G I+ +EF+
Sbjct: 86  LKEAFRVFDKDQNGFISAAELRHVMTNLGEKLSDEEVDEMIREADVDGDGQINYEEFV 143



 Score = 32.3 bits (70), Expect = 0.25
 Identities = 14/54 (25%), Positives = 27/54 (50%)
 Frame = +3

Query: 309 FRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFL 470
           F   D DG   +  +E    ++  G    ++E +++ ++ D D +G+I   EFL
Sbjct: 17  FSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFL 70


>At4g14640.1 68417.m02252 calmodulin-8 (CAM8) identical to
           calmodulin 8 GI:5825600 from [Arabidopsis thaliana]
          Length = 151

 Score = 34.7 bits (76), Expect = 0.047
 Identities = 18/64 (28%), Positives = 30/64 (46%)
 Frame = +3

Query: 309 FRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFLIKIRPP 488
           F   D DG   +  EE    I+       + E  ++ ++ D+DS+G+I   EFL  +   
Sbjct: 18  FCLFDKDGDGCITVEELATVIRSLDQNPTEQELHDIITEIDSDSNGTIEFAEFLNLMAKK 77

Query: 489 MSES 500
           + ES
Sbjct: 78  LQES 81


>At3g56800.1 68416.m06317 calmodulin-2/3/5 (CAM3) identical to
           calmodulin GI:474183 from [Arabidopsis thaliana]; almost
           identical to calmodulin-2/3/5 SP:P25069 [Arabidopsis
           thaliana]
          Length = 149

 Score = 34.7 bits (76), Expect = 0.047
 Identities = 16/58 (27%), Positives = 28/58 (48%)
 Frame = +3

Query: 297 LGRIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFL 470
           L   FR  D D +  ++  E  + +   G +L   E +E+  + D D  G I+ +EF+
Sbjct: 86  LKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIKEADVDGDGQINYEEFV 143



 Score = 32.3 bits (70), Expect = 0.25
 Identities = 14/54 (25%), Positives = 27/54 (50%)
 Frame = +3

Query: 309 FRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFL 470
           F   D DG   +  +E    ++  G    ++E +++ ++ D D +G+I   EFL
Sbjct: 17  FSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFL 70


>At2g41110.1 68415.m05078 calmodulin-2/3/5 (CAM2) (CAL1) almost
           identical to Calmodulin-2/3/5 SP:P25069 from
           [Arabidopsis thaliana]
          Length = 149

 Score = 34.7 bits (76), Expect = 0.047
 Identities = 16/58 (27%), Positives = 28/58 (48%)
 Frame = +3

Query: 297 LGRIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFL 470
           L   FR  D D +  ++  E  + +   G +L   E +E+  + D D  G I+ +EF+
Sbjct: 86  LKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIKEADVDGDGQINYEEFV 143



 Score = 32.3 bits (70), Expect = 0.25
 Identities = 14/54 (25%), Positives = 27/54 (50%)
 Frame = +3

Query: 309 FRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFL 470
           F   D DG   +  +E    ++  G    ++E +++ ++ D D +G+I   EFL
Sbjct: 17  FSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFL 70


>At2g27030.2 68415.m03246 calmodulin-2/3/5 (CAM5) (TCH1) identical
           to calmodulin GI:474183 from [Arabidopsis thaliana],
           SP|P25069 Calmodulin-2/3/5 {Arabidopsis thaliana}
          Length = 113

 Score = 34.7 bits (76), Expect = 0.047
 Identities = 16/58 (27%), Positives = 28/58 (48%)
 Frame = +3

Query: 297 LGRIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFL 470
           L   FR  D D +  ++  E  + +   G +L   E +E+  + D D  G I+ +EF+
Sbjct: 50  LKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIKEADVDGDGQINYEEFV 107


>At2g27030.1 68415.m03245 calmodulin-2/3/5 (CAM5) (TCH1) identical
           to calmodulin GI:474183 from [Arabidopsis thaliana],
           SP|P25069 Calmodulin-2/3/5 {Arabidopsis thaliana}
          Length = 149

 Score = 34.7 bits (76), Expect = 0.047
 Identities = 16/58 (27%), Positives = 28/58 (48%)
 Frame = +3

Query: 297 LGRIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFL 470
           L   FR  D D +  ++  E  + +   G +L   E +E+  + D D  G I+ +EF+
Sbjct: 86  LKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIKEADVDGDGQINYEEFV 143



 Score = 32.3 bits (70), Expect = 0.25
 Identities = 14/54 (25%), Positives = 27/54 (50%)
 Frame = +3

Query: 309 FRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFL 470
           F   D DG   +  +E    ++  G    ++E +++ ++ D D +G+I   EFL
Sbjct: 17  FSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFL 70


>At3g43810.1 68416.m04682 calmodulin-7 (CAM7) almost identical to
           calmodulin GI:16227 from [Arabidopsis thaliana],
           SP|P59220 Calmodulin-7 {Arabidopsis thaliana}
          Length = 149

 Score = 34.3 bits (75), Expect = 0.063
 Identities = 16/58 (27%), Positives = 28/58 (48%)
 Frame = +3

Query: 297 LGRIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFL 470
           L   FR  D D +  ++  E  + +   G +L   E +E+  + D D  G I+ +EF+
Sbjct: 86  LKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFV 143



 Score = 32.3 bits (70), Expect = 0.25
 Identities = 14/54 (25%), Positives = 27/54 (50%)
 Frame = +3

Query: 309 FRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFL 470
           F   D DG   +  +E    ++  G    ++E +++ ++ D D +G+I   EFL
Sbjct: 17  FSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFL 70


>At3g03000.1 68416.m00295 calmodulin, putative similar to calmodulin
           SP:P04352 from [Chlamydomonas reinhardtii]; contains
           Pfam profile: PF00036 EF hand (4 copies)
          Length = 165

 Score = 34.3 bits (75), Expect = 0.063
 Identities = 17/58 (29%), Positives = 25/58 (43%)
 Frame = +3

Query: 297 LGRIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFL 470
           L  IFR  D DG+  +   E  + + + G  L   E   +  + D D  G I   EF+
Sbjct: 95  LKAIFRMFDRDGNGYITAAELAHSMAKLGHALTAEELTGMIKEADRDGDGCIDFQEFV 152


>At1g76640.1 68414.m08918 calmodulin-related protein, putative
           similar to regulator of gene silencing
           calmodulin-related protein GI:12963415 from [Nicotiana
           tabacum]
          Length = 159

 Score = 34.3 bits (75), Expect = 0.063
 Identities = 21/73 (28%), Positives = 33/73 (45%), Gaps = 2/73 (2%)
 Frame = +3

Query: 297 LGRIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEF--L 470
           L  +F  MD +    ++ EE     K  G +++  EAE      D D  G + ++EF  L
Sbjct: 23  LEAVFAYMDANRDGRISAEELKKSFKTLGEQMSDEEAEAAVKLSDIDGDGMLDINEFALL 82

Query: 471 IKIRPPMSESRRK 509
           IK     +E  +K
Sbjct: 83  IKGNDEFTEEEKK 95


>At1g66400.1 68414.m07541 calmodulin-related protein, putative
           similar to calmodulin-related protein 2, touch-induced
           from SP:P25070 [Arabidopsis thaliana]; contains Pfam
           profile: PF00036 EF hand (4 copies)
          Length = 157

 Score = 34.3 bits (75), Expect = 0.063
 Identities = 18/69 (26%), Positives = 35/69 (50%), Gaps = 1/69 (1%)
 Frame = +3

Query: 267 LSRGASGIL-GLGRIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSS 443
           +SR   G +  + ++F+R D +    ++ +E    I       ++ E + +  +FD D +
Sbjct: 5   VSRNCLGSMEDIKKVFQRFDKNNDGKISIDELKDVIGALSPNASQEETKAMMKEFDLDGN 64

Query: 444 GSISLDEFL 470
           G I LDEF+
Sbjct: 65  GFIDLDEFV 73



 Score = 28.3 bits (60), Expect = 4.1
 Identities = 9/22 (40%), Positives = 17/22 (77%)
 Frame = +2

Query: 512 VEQAFKKLDKTGDGAITIDDIK 577
           +++ F++ DK  DG I+ID++K
Sbjct: 16  IKKVFQRFDKNNDGKISIDELK 37



 Score = 27.1 bits (57), Expect = 9.5
 Identities = 15/66 (22%), Positives = 29/66 (43%)
 Frame = +3

Query: 270 SRGASGILGLGRIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGS 449
           S   S I  L   F   D D +  ++  E    +K  G + +  + + + ++ D+D  G 
Sbjct: 82  SSNNSAIRDLKEAFDLYDLDRNGRISANELHSVMKNLGEKCSIQDCQRMINKVDSDGDGC 141

Query: 450 ISLDEF 467
           +  +EF
Sbjct: 142 VDFEEF 147


>At1g18210.2 68414.m02267 calcium-binding protein, putative similar
           to SP|Q9M7R0 Calcium-binding allergen Ole e 8
           (PCA18/PCA23) {Olea europaea}; contains
           INTERPRO:IPR002048 calcium-binding EF-hand domain
          Length = 170

 Score = 34.3 bits (75), Expect = 0.063
 Identities = 17/57 (29%), Positives = 28/57 (49%)
 Frame = +3

Query: 297 LGRIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEF 467
           L ++F + D +G   ++  E     K  G    ++E   +  + DTD  G I+LDEF
Sbjct: 24  LKKVFDQFDSNGDGKISVLELGGVFKAMGTSYTETELNRVLEEVDTDRDGYINLDEF 80



 Score = 29.9 bits (64), Expect = 1.3
 Identities = 14/67 (20%), Positives = 28/67 (41%)
 Frame = +3

Query: 267 LSRGASGILGLGRIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSG 446
           L R +S    +   F   D D + L++  E    +   G+  +  +   +    D D  G
Sbjct: 83  LCRSSSSAAEIRDAFDLYDQDKNGLISASELHQVLNRLGMSCSVEDCTRMIGPVDADGDG 142

Query: 447 SISLDEF 467
           +++ +EF
Sbjct: 143 NVNFEEF 149


>At1g18210.1 68414.m02266 calcium-binding protein, putative similar
           to SP|Q9M7R0 Calcium-binding allergen Ole e 8
           (PCA18/PCA23) {Olea europaea}; contains
           INTERPRO:IPR002048 calcium-binding EF-hand domain
          Length = 170

 Score = 34.3 bits (75), Expect = 0.063
 Identities = 17/57 (29%), Positives = 28/57 (49%)
 Frame = +3

Query: 297 LGRIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEF 467
           L ++F + D +G   ++  E     K  G    ++E   +  + DTD  G I+LDEF
Sbjct: 24  LKKVFDQFDSNGDGKISVLELGGVFKAMGTSYTETELNRVLEEVDTDRDGYINLDEF 80



 Score = 29.9 bits (64), Expect = 1.3
 Identities = 14/67 (20%), Positives = 28/67 (41%)
 Frame = +3

Query: 267 LSRGASGILGLGRIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSG 446
           L R +S    +   F   D D + L++  E    +   G+  +  +   +    D D  G
Sbjct: 83  LCRSSSSAAEIRDAFDLYDQDKNGLISASELHQVLNRLGMSCSVEDCTRMIGPVDADGDG 142

Query: 447 SISLDEF 467
           +++ +EF
Sbjct: 143 NVNFEEF 149


>At5g07320.1 68418.m00836 mitochondrial substrate carrier family
           protein similar to peroxisomal Ca-dependent solute
           carrier [Oryctolagus cuniculus] GI:2352427
           (mitochondrial carrier superfamily); contains
           INTERPRO:IPR001993 Mitochondrial substrate carrier
           family, INTERPRO:IPR002048 calcium-binding EF-hand
           domain
          Length = 479

 Score = 33.9 bits (74), Expect = 0.083
 Identities = 16/59 (27%), Positives = 32/59 (54%)
 Frame = +3

Query: 291 LGLGRIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEF 467
           L L RIF+ +D + +  +  EE    + + G+E++  E        D D++G+I+ +E+
Sbjct: 103 LELYRIFQAIDVEHNGCILPEELWEALVKAGIEIDDEELARFVEHVDKDNNGTITFEEW 161



 Score = 27.1 bits (57), Expect = 9.5
 Identities = 15/37 (40%), Positives = 20/37 (54%)
 Frame = +3

Query: 276 GASGILGLGRIFRRMDDDGSKLLNKEEFLYGIKETGL 386
           GAS +  L  +  RM  D SK   K+EF+  +K  GL
Sbjct: 408 GASCVYPLQVVRTRMQADSSKTTMKQEFMNTMKGEGL 444


>At3g25600.1 68416.m03187 calmodulin, putative similar to calmodulin
           GI:239841 from [Paramecium tetraurelia]
          Length = 161

 Score = 33.9 bits (74), Expect = 0.083
 Identities = 17/57 (29%), Positives = 28/57 (49%)
 Frame = +3

Query: 297 LGRIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEF 467
           L  +FR  D DG+  +   E    + + G  L   E  E+ ++ D++  G IS +EF
Sbjct: 88  LMEVFRSFDRDGNGSITAAELAGSMAKMGHPLTYRELTEMMTEADSNGDGVISFNEF 144


>At3g03430.1 68416.m00341 polcalcin, putative / calcium-binding
           pollen allergen, putative almost identical to polcalcin
           Bra r 2/Bra n 2 (calcium-binding pollen allergen Bra r
           2/Bra n 2) SP:Q39406 from [Brassica napus]
          Length = 83

 Score = 33.9 bits (74), Expect = 0.083
 Identities = 16/56 (28%), Positives = 29/56 (51%)
 Frame = +3

Query: 303 RIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFL 470
           RIF++ D +G   ++  E    +K  G  +   + + + ++ DTD  G IS  EF+
Sbjct: 12  RIFKKFDANGDGKISAAELGDALKNLG-SVTHEDIKRMMAEIDTDGDGYISYQEFI 66


>At2g15680.1 68415.m01795 calmodulin-related protein, putative
           similar to calmodulin-related protein 2, touch-induced
           SP:P25070 from [Arabidopsis thaliana]
          Length = 187

 Score = 33.9 bits (74), Expect = 0.083
 Identities = 17/56 (30%), Positives = 29/56 (51%)
 Frame = +3

Query: 303 RIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFL 470
           +IF+ +D DG   ++  EF+   K +G  +  S+    F  FD +  G IS +E +
Sbjct: 89  KIFKAVDLDGDGFIDFREFIDAYKRSG-GIRSSDIRNSFWTFDLNGDGKISAEEVM 143


>At1g18890.1 68414.m02351 calcium-dependent protein kinase 1 (CDPK1)
           identical to calcium-dependent protein kinase
           [Arabidopsis thaliana] gi|604880|dbj|BAA04829; contains
           protein kinase domain, Pfam:PF00069; contains EF hand
           domain (calcium-binding EF-hand), Pfam:PF00036,
           INTERPRO:IPR002048
          Length = 545

 Score = 33.9 bits (74), Expect = 0.083
 Identities = 17/58 (29%), Positives = 28/58 (48%)
 Frame = +3

Query: 306 IFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFLIKI 479
           +F  MDDD    +   E   G+++ G +L + E + L    D D +G +   EF+  I
Sbjct: 372 MFSLMDDDKDGKITYPELKAGLQKVGSQLGEPEIKMLMEVADVDGNGFLDYGEFVAVI 429



 Score = 32.3 bits (70), Expect = 0.25
 Identities = 16/58 (27%), Positives = 28/58 (48%)
 Frame = +3

Query: 309 FRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFLIKIR 482
           F   D DGS  +  +E    + +   E + S   ++  + DTD  G I+ DEF+  ++
Sbjct: 445 FMFFDKDGSTYIELDELREALADELGEPDASVLSDIMREVDTDKDGRINYDEFVTMMK 502


>At5g42380.1 68418.m05160 calmodulin-related protein, putative
           similar to regulator of gene silencing
           calmodulin-related protein GI:12963415 from [Nicotiana
           tabacum]
          Length = 185

 Score = 33.5 bits (73), Expect = 0.11
 Identities = 27/91 (29%), Positives = 40/91 (43%), Gaps = 4/91 (4%)
 Frame = +3

Query: 249 ETRLLCLSRGASG--ILGLGRIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFS 422
           E+R    S G+S   +  L  +F  MD +    ++ EE    +   G  L+  E EE+  
Sbjct: 32  ESRTSSNSSGSSSLNVNELRTVFDYMDANSDGKISGEELQSCVSLLGGALSSREVEEVVK 91

Query: 423 QFDTDSSGSISLDEF--LIKIRPPMSESRRK 509
             D D  G I  +EF  L++      E RRK
Sbjct: 92  TSDVDGDGFIDFEEFLKLMEGEDGSDEERRK 122


>At3g59440.1 68416.m06630 calcium-binding protein, putative similar
           to calcium-binding protein [Lotus japonicus] GI:18413495
          Length = 195

 Score = 33.5 bits (73), Expect = 0.11
 Identities = 13/57 (22%), Positives = 29/57 (50%)
 Frame = +3

Query: 297 LGRIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEF 467
           L R+F+  D +G   + KEE    ++  G+ +   +  ++  + D +  G + ++EF
Sbjct: 52  LKRVFQMFDKNGDGRITKEELNDSLENLGIFMPDKDLIQMIQKMDANGDGCVDINEF 108


>At3g07490.1 68416.m00893 calcium-binding protein, putative similar
           to calcium-binding protein GI:6580549 from [Lotus
           japonicus]
          Length = 153

 Score = 33.5 bits (73), Expect = 0.11
 Identities = 13/57 (22%), Positives = 29/57 (50%)
 Frame = +3

Query: 297 LGRIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEF 467
           L RIF+  D +G   + K+E    ++  G+ +   +  ++  + D +  G + ++EF
Sbjct: 6   LARIFQMFDRNGDGKITKQELNDSLENLGIYIPDKDLVQMIEKIDLNGDGYVDIEEF 62


>At4g36070.1 68417.m05135 calcium-dependent protein kinase family
           protein / CDPK family protein contains Pfam domains,
           PF00069: Protein kinase domain and PF00036: EF hand
          Length = 536

 Score = 33.1 bits (72), Expect = 0.14
 Identities = 21/67 (31%), Positives = 32/67 (47%), Gaps = 2/67 (2%)
 Frame = +3

Query: 309 FRRMDDDGSKLLNKEEFLYG--IKETGLELNKSEAEELFSQFDTDSSGSISLDEFLIKIR 482
           F + D DG   +  EE      +++TGL   K   E L  + D D  G IS++EF   +R
Sbjct: 459 FDKFDIDGDGFITPEELRLNQCLQQTGL---KGSIEPLLEEADVDEDGRISINEFRRLLR 515

Query: 483 PPMSESR 503
               +S+
Sbjct: 516 SASLKSK 522


>At4g32060.1 68417.m04563 calcium-binding EF hand family protein
           contains INTERPRO:IPR002048 calcium-binding EF-hand
           domain
          Length = 498

 Score = 32.7 bits (71), Expect = 0.19
 Identities = 17/53 (32%), Positives = 29/53 (54%)
 Frame = +3

Query: 309 FRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEF 467
           F   D D   L++ +E+++ +  T L + +S     F  FDTD++G I  +EF
Sbjct: 218 FMLFDVDNDGLISFKEYIFFV--TLLSIPESSFAVAFKMFDTDNNGEIDKEEF 268



 Score = 29.9 bits (64), Expect = 1.3
 Identities = 15/45 (33%), Positives = 26/45 (57%), Gaps = 1/45 (2%)
 Frame = +3

Query: 339 LLNKEEFLYGIKET-GLELNKSEAEELFSQFDTDSSGSISLDEFL 470
           LL  ++F     +  G+ L+ +  E  F  FD++  G++S+DEFL
Sbjct: 419 LLTMKDFKRAASQVCGITLSDNVIEIAFHVFDSNQDGNLSVDEFL 463


>At3g22930.1 68416.m02889 calmodulin, putative strong similarity to
           calmodulin 8 GI:5825600 from [Arabidopsis thaliana];
           contains INTERPRO:IPR002048 calcium-binding EF-hand
           domain
          Length = 173

 Score = 32.7 bits (71), Expect = 0.19
 Identities = 15/61 (24%), Positives = 28/61 (45%)
 Frame = +3

Query: 288 ILGLGRIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEF 467
           I+     F   D DG   +  +E    I+       + E +++ ++ D+D +G+I   EF
Sbjct: 33  IMEFKEAFCLFDKDGDGCITADELATVIRSLDQNPTEQELQDMITEIDSDGNGTIEFSEF 92

Query: 468 L 470
           L
Sbjct: 93  L 93


>At3g10190.1 68416.m01220 calmodulin, putative similar to calmodulin
           NtCaM13 [Nicotiana tabacum] GI:14625425, calmodulin
           GB:AAA34015 [Glycine max]; contains INTERPRO:IPR002048
           calcium-binding EF-hand domain
          Length = 209

 Score = 32.7 bits (71), Expect = 0.19
 Identities = 17/55 (30%), Positives = 25/55 (45%)
 Frame = +3

Query: 306 IFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFL 470
           + + +D DG   +  EE    +       + +E +E F  FD D  G IS DE L
Sbjct: 111 MLKEVDCDGDGTIRLEELASRVVSLDPARDSTELKETFEFFDADRDGLISADELL 165


>At5g55990.1 68418.m06986 calcineurin B-like protein 2 (CBL2)
           identical to calcineurin B-like protein 2 GI:3309084
           from [Arabidopsis thaliana]
          Length = 226

 Score = 32.3 bits (70), Expect = 0.25
 Identities = 21/51 (41%), Positives = 29/51 (56%), Gaps = 3/51 (5%)
 Frame = +3

Query: 324 DDGSKLLNKEEFLYGIKETGLELNKSE---AEELFSQFDTDSSGSISLDEF 467
           DDG  L+NKEEF   + +T    NK E   A+ +F  FDT  +G +  +EF
Sbjct: 63  DDG--LINKEEFQLALFKT----NKKESLFADRVFDLFDTKHNGILGFEEF 107


>At4g26570.1 68417.m03830 calcineurin B-like protein 3 (CBL3)
           identical to calcineurin B-like protein 3 (GI:22136404)
           [Arabidopsis thaliana]
          Length = 226

 Score = 32.3 bits (70), Expect = 0.25
 Identities = 21/51 (41%), Positives = 29/51 (56%), Gaps = 3/51 (5%)
 Frame = +3

Query: 324 DDGSKLLNKEEFLYGIKETGLELNKSE---AEELFSQFDTDSSGSISLDEF 467
           DDG  L+NKEEF   + +T    NK E   A+ +F  FDT  +G +  +EF
Sbjct: 63  DDG--LINKEEFQLALFKT----NKKESLFADRVFDLFDTKHNGILGFEEF 107


>At1g76650.1 68414.m08919 calcium-binding EF hand family protein
           similar to regulator of gene silencing
           calmodulin-related protein GI:12963415 from [Nicotiana
           tabacum]; contains INTERPRO:IPR002048 calcium-binding
           EF-hand domain
          Length = 177

 Score = 32.3 bits (70), Expect = 0.25
 Identities = 24/82 (29%), Positives = 35/82 (42%), Gaps = 2/82 (2%)
 Frame = +3

Query: 240 SSGETRLLCLSRGASGILGLGRIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELF 419
           S+GE +    S G      L  +F  MD +    ++ EE        G +L+  EA    
Sbjct: 25  SAGEIQQHNSSNGEDKNRELEAVFSYMDANRDGRISPEELQKSFMTLGEQLSDEEAVAAV 84

Query: 420 SQFDTDSSGSISLDEF--LIKI 479
              DTD  G +  +EF  LIK+
Sbjct: 85  RLSDTDGDGMLDFEEFSQLIKV 106


>At5g17470.1 68418.m02050 calmodulin-related protein, putative
           similar to calmodulin-related protein 2, touch-induced
           SP:P25070 from [Arabidopsis thaliana]
          Length = 146

 Score = 31.9 bits (69), Expect = 0.33
 Identities = 13/59 (22%), Positives = 27/59 (45%)
 Frame = +3

Query: 291 LGLGRIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEF 467
           + +  IF R+D +    ++ +EF   I+     +   E + +F + D D    I + E+
Sbjct: 1   MSVAEIFERVDKNKDGKISWDEFAEAIRAFSPSITSEEIDNMFREIDVDGDNQIDVAEY 59


>At2g44310.1 68415.m05513 calcium-binding EF hand family protein
           contains INTERPRO:IPR002048 calcium-binding EF-hand
           domain
          Length = 142

 Score = 31.5 bits (68), Expect = 0.44
 Identities = 11/20 (55%), Positives = 16/20 (80%)
 Frame = +3

Query: 408 EELFSQFDTDSSGSISLDEF 467
           + +F +FDTD SGS+ L+EF
Sbjct: 75  DSIFEKFDTDQSGSVDLEEF 94


>At4g26470.1 68417.m03808 calcium-binding EF hand family protein low
           similarity to SP|P06787 Calmodulin {Saccharomyces
           cerevisiae}; contains INTERPRO:IPR002048 calcium-binding
           EF-hand domain
          Length = 248

 Score = 31.1 bits (67), Expect = 0.58
 Identities = 14/63 (22%), Positives = 30/63 (47%)
 Frame = +3

Query: 285 GILGLGRIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDE 464
           G+     IF+  D+D +  ++  E    I++  +  ++ E  +LF   D +    I+  E
Sbjct: 55  GLRNCKAIFQEFDEDSNGSIDHTELKNCIRKLEISFDEEEINDLFKACDINEDMGITFTE 114

Query: 465 FLI 473
           F++
Sbjct: 115 FIV 117


>At3g03400.1 68416.m00337 calmodulin-related protein, putative
           similar to calmodulin-related protein 2, touch-induced
           SP:P25070 from [Arabidopsis thaliana]
          Length = 137

 Score = 30.7 bits (66), Expect = 0.77
 Identities = 16/59 (27%), Positives = 25/59 (42%)
 Frame = +3

Query: 291 LGLGRIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEF 467
           + L  IF R D      ++ EEF   I      +   +  E+F Q DT+  G +   +F
Sbjct: 4   MSLSDIFERFDTSKDGKISWEEFRDAIHALSPSIPSEKLVEMFIQLDTNGDGQVDAAKF 62



 Score = 27.9 bits (59), Expect = 5.4
 Identities = 10/26 (38%), Positives = 15/26 (57%)
 Frame = +3

Query: 390 LNKSEAEELFSQFDTDSSGSISLDEF 467
           +N     ++F +FDT   G IS +EF
Sbjct: 1   MNNMSLSDIFERFDTSKDGKISWEEF 26


>At1g73630.1 68414.m08524 calcium-binding protein, putative similar
           to calcium binding protein GI:14589311 from [Sesbania
           rostrata]; contains Pfam profile: PF00036 EF hand (4
           copies)
          Length = 163

 Score = 30.3 bits (65), Expect = 1.0
 Identities = 13/67 (19%), Positives = 30/67 (44%)
 Frame = +3

Query: 267 LSRGASGILGLGRIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSG 446
           + R +S  + +   F   D + + L++  E    +   G+  +  +   +    DTD  G
Sbjct: 80  ICRSSSSAVEIREAFDLYDQNKNGLISSSEIHKVLNRLGMTCSVEDCVRMIGHVDTDGDG 139

Query: 447 SISLDEF 467
           +++ +EF
Sbjct: 140 NVNFEEF 146


>At1g05990.1 68414.m00627 calcium-binding protein, putative strong
           similarity to calcium-binding protein [Lotus japonicus]
           GI:18413495; contains INTERPRO:IPR002048 calcium-binding
           EF-hand domain
          Length = 150

 Score = 30.3 bits (65), Expect = 1.0
 Identities = 11/25 (44%), Positives = 18/25 (72%)
 Frame = +2

Query: 512 VEQAFKKLDKTGDGAITIDDIKGCL 586
           +++AF   D+ GDG IT+D++K  L
Sbjct: 80  MKEAFNVFDQNGDGFITVDELKAVL 104


>At2g45670.1 68415.m05678 calcineurin B subunit-related contains
           Pfam PF00036: EF hand domain and Prosite PS00018:
           EF-hand calcium-binding domain; contains Pfam profile
           PF01553: Acyltransferase; weak similarity to Calcineurin
           B subunit isoform 2 (Protein phosphatase 2B regulatory
           subunit 2) (Protein phosphatase 3 regulatory subunit B
           alpha isoform 2) (Swiss-Prot:Q63811) [Mus musculus]
          Length = 539

 Score = 29.9 bits (64), Expect = 1.3
 Identities = 17/58 (29%), Positives = 25/58 (43%)
 Frame = +3

Query: 309 FRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFLIKIR 482
           F   D DG   +  +E    +K T   LNK E   ++   D D    IS ++ L  +R
Sbjct: 466 FSHCDADGDGYITIQELGEALKNTIPNLNKDEIRGMYHLLDDDQDQRISQNDLLSCLR 523


>At5g51050.1 68418.m06328 mitochondrial substrate carrier family
           protein similar to peroxisomal Ca-dependent solute
           carrier [Oryctolagus cuniculus] GI:2352427; contains
           INTERPRO:IPR001993 Mitochondrial substrate carrier
           family, INTERPRO:IPR002048 calcium-binding EF-hand
           domain
          Length = 487

 Score = 29.5 bits (63), Expect = 1.8
 Identities = 15/59 (25%), Positives = 28/59 (47%)
 Frame = +3

Query: 291 LGLGRIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEF 467
           L L RIF+ +D + +  ++ E     + + G+E+   E        D D+ G I  +E+
Sbjct: 106 LELYRIFQAIDVEHNGCISPEGLWDSLVKAGIEIKDEELARFVEHVDKDNDGIIMFEEW 164


>At4g03560.1 68417.m00488 two-pore calcium channel (TPC1) identical
           to two-pore calcium channel (TPC1) [Arabidopsis
           thaliana] gi|14041819|dbj|BAB55460
          Length = 733

 Score = 29.5 bits (63), Expect = 1.8
 Identities = 15/43 (34%), Positives = 19/43 (44%)
 Frame = +3

Query: 300 GRIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQF 428
           G IF  +DD     +NK+EF    +   L   K E   LF  F
Sbjct: 369 GLIFDELDDTRDFKINKDEFADLCQAIALRFQKEEVPSLFEHF 411


>At3g03410.1 68416.m00339 calmodulin-related protein, putative
           similar to calmodulin-related protein 2, touch-induced
           SP:P25070 from [Arabidopsis thaliana]
          Length = 131

 Score = 29.5 bits (63), Expect = 1.8
 Identities = 15/65 (23%), Positives = 28/65 (43%)
 Frame = +3

Query: 303 RIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFLIKIR 482
           R+F + D +    L+ +EF            + +  + F + D D +G ++ DEF   I 
Sbjct: 5   RVFEKFDKNKDGKLSLDEFREVALAFSPYFTQEDIVKFFEEIDVDGNGELNADEFTSCIE 64

Query: 483 PPMSE 497
             + E
Sbjct: 65  KMLKE 69



 Score = 27.5 bits (58), Expect = 7.2
 Identities = 10/21 (47%), Positives = 15/21 (71%)
 Frame = +3

Query: 405 AEELFSQFDTDSSGSISLDEF 467
           A+ +F +FD +  G +SLDEF
Sbjct: 3   AKRVFEKFDKNKDGKLSLDEF 23


>At4g38230.1 68417.m05399 calcium-dependent protein kinase, putative
           / CDPK, putative calmodulin-domain protein kinase CDPK
           isoform 6 [Arabidopsis thaliana] gi|1399275|gb|AAB03246;
           contains protein kinase domain, Pfam:PF00069; contains
           EF hand domain (calcium-binding EF-hand), Pfam:PF00036,
           INTERPRO:IPR002048
          Length = 340

 Score = 29.1 bits (62), Expect = 2.4
 Identities = 16/45 (35%), Positives = 25/45 (55%)
 Frame = +3

Query: 348 KEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFLIKIR 482
           K+  L  I E+  E   +  +E+F   DTD+SG+I+ DE    +R
Sbjct: 167 KQMALRVIAESLSEEEIAGLKEMFKAMDTDNSGAITFDELKAGLR 211



 Score = 27.5 bits (58), Expect = 7.2
 Identities = 15/31 (48%), Positives = 18/31 (58%), Gaps = 4/31 (12%)
 Frame = +3

Query: 384 LELNKSEAEE----LFSQFDTDSSGSISLDE 464
           + LNK E EE     F  FD D SG I++DE
Sbjct: 247 IHLNKLEREEHLLSAFRYFDKDGSGYITIDE 277


>At5g57190.1 68418.m07144 phosphatidylserine decarboxylase, putative
           similar to SP|P53037 Phosphatidylserine decarboxylase
           proenzyme 2 precursor (EC 4.1.1.65) {Saccharomyces
           cerevisiae}; contains Pfam profile PF02666:
           phosphatidylserine decarboxylase
          Length = 615

 Score = 28.7 bits (61), Expect = 3.1
 Identities = 11/24 (45%), Positives = 15/24 (62%)
 Frame = +2

Query: 515 EQAFKKLDKTGDGAITIDDIKGCL 586
           E+ FK  D  GDG +TID++   L
Sbjct: 196 EELFKAADLNGDGVVTIDELAALL 219



 Score = 27.1 bits (57), Expect = 9.5
 Identities = 17/54 (31%), Positives = 27/54 (50%)
 Frame = +3

Query: 303 RIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDE 464
           RI   +D +    L+  EF   IK  G  +  ++ EELF   D +  G +++DE
Sbjct: 161 RILSIVDYNEDGQLSFSEFSDLIKAFGNLVAANKKEELFKAADLNGDGVVTIDE 214


>At4g26560.1 68417.m03828 calcineurin B-like protein, putative
           similar to calcineurin B-like protein 3 [Arabidopsis
           thaliana] GI:3309086, calcineurin B-like protein 2
           [Arabidopsis thaliana] GI:3309084; contains
           INTERPRO:IPR002048 calcium-binding EF-hand domain
          Length = 214

 Score = 28.7 bits (61), Expect = 3.1
 Identities = 16/43 (37%), Positives = 26/43 (60%), Gaps = 1/43 (2%)
 Frame = +3

Query: 342 LNKEEFLYGIKETGLELNKSE-AEELFSQFDTDSSGSISLDEF 467
           +NKE+F   I +T  + N+S  +E +F  FDT+  G +  +EF
Sbjct: 55  MNKEQFHVAIFQT--DKNESLFSERVFDLFDTNHDGLLGFEEF 95


>At4g25970.1 68417.m03737 phosphatidylserine decarboxylase, putative
           similar to SP|P53037 Phosphatidylserine decarboxylase
           proenzyme 2 precursor (EC 4.1.1.65) {Saccharomyces
           cerevisiae}; contains Pfam profile PF02666:
           phosphatidylserine decarboxylase
          Length = 635

 Score = 28.7 bits (61), Expect = 3.1
 Identities = 11/24 (45%), Positives = 15/24 (62%)
 Frame = +2

Query: 515 EQAFKKLDKTGDGAITIDDIKGCL 586
           E+ FK  D  GDG +TID++   L
Sbjct: 217 EELFKAADLNGDGVVTIDELAALL 240


>At4g26570.2 68417.m03831 calcineurin B-like protein 3 (CBL3)
           identical to calcineurin B-like protein 3 (GI:22136404)
           [Arabidopsis thaliana]
          Length = 230

 Score = 28.3 bits (60), Expect = 4.1
 Identities = 18/52 (34%), Positives = 30/52 (57%), Gaps = 4/52 (7%)
 Frame = +3

Query: 324 DDGSKLLNKEEFLYGI----KETGLELNKSEAEELFSQFDTDSSGSISLDEF 467
           DDG  L+NKEEF   +    K+  L  ++ +++ +F  FDT  +G +  +EF
Sbjct: 63  DDG--LINKEEFQLALFKTNKKESLFADRYQSQ-VFDLFDTKHNGILGFEEF 111


>At5g49150.1 68418.m06083 hypothetical protein
          Length = 896

 Score = 27.9 bits (59), Expect = 5.4
 Identities = 15/39 (38%), Positives = 22/39 (56%)
 Frame = +3

Query: 378 TGLELNKSEAEELFSQFDTDSSGSISLDEFLIKIRPPMS 494
           +GLE++ S+  E  S      SGS+ L   L++ RPP S
Sbjct: 587 SGLEISYSDLLENISVMVQALSGSVILSPMLMQFRPPGS 625


>At1g55610.1 68414.m06365 protein kinase family protein contains
            Prosite:PS00107: Protein kinases ATP-binding region
            signature
          Length = 1166

 Score = 27.9 bits (59), Expect = 5.4
 Identities = 13/32 (40%), Positives = 18/32 (56%)
 Frame = +3

Query: 414  LFSQFDTDSSGSISLDEFLIKIRPPMSESRRK 509
            +F +   D+    SLDEF +K  P + ESR K
Sbjct: 1133 MFKEMKADTEEDESLDEFSLKETPLVEESRDK 1164


>At3g23950.1 68416.m03008 F-box family protein contains Pfam:PF00646
           F-box domain
          Length = 418

 Score = 27.5 bits (58), Expect = 7.2
 Identities = 12/31 (38%), Positives = 21/31 (67%)
 Frame = -2

Query: 348 CSVVYFHHHPCDGKFFQVPRSLKHLGTSKAS 256
           CS++YF   P +GK +++PR  + + TS+ S
Sbjct: 244 CSIIYF---PDNGKDYELPRFRRTITTSEGS 271


>At2g41860.2 68415.m05174 calcium-dependent protein kinase, putative
           / CDPK, putative similar to calmodulin-domain protein
           kinase CDPK isoform 7 [Arabidopsis thaliana]
           gi|1399277|gb|AAB03247
          Length = 530

 Score = 27.5 bits (58), Expect = 7.2
 Identities = 20/87 (22%), Positives = 38/87 (43%)
 Frame = +3

Query: 297 LGRIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFLIK 476
           L + F   D + S  +  EE    + +     ++   E +    DT+  G IS DEF   
Sbjct: 432 LKKAFTFFDKNKSGYIEIEELRDALADDVDTTSEEVVEAIILDVDTNKDGKISYDEFATM 491

Query: 477 IRPPMSESRRKL*NKHSRSLTRLVTVQ 557
           ++       RK   ++SR L + ++++
Sbjct: 492 MK--TGTDWRKASRQYSRDLFKCLSLK 516


>At2g41860.1 68415.m05173 calcium-dependent protein kinase, putative
           / CDPK, putative similar to calmodulin-domain protein
           kinase CDPK isoform 7 [Arabidopsis thaliana]
           gi|1399277|gb|AAB03247
          Length = 425

 Score = 27.5 bits (58), Expect = 7.2
 Identities = 20/87 (22%), Positives = 38/87 (43%)
 Frame = +3

Query: 297 LGRIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFLIK 476
           L + F   D + S  +  EE    + +     ++   E +    DT+  G IS DEF   
Sbjct: 327 LKKAFTFFDKNKSGYIEIEELRDALADDVDTTSEEVVEAIILDVDTNKDGKISYDEFATM 386

Query: 477 IRPPMSESRRKL*NKHSRSLTRLVTVQ 557
           ++       RK   ++SR L + ++++
Sbjct: 387 MK--TGTDWRKASRQYSRDLFKCLSLK 411


>At2g36180.1 68415.m04440 calmodulin-related protein, putative
           similar to calmodulin-related protein 2, touch-induced
           SP:P25070 from [Arabidopsis thaliana]
          Length = 144

 Score = 27.5 bits (58), Expect = 7.2
 Identities = 14/57 (24%), Positives = 25/57 (43%)
 Frame = +3

Query: 297 LGRIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEF 467
           +  IF  +D +    +  +EF   I+    ++   E +++F   D D  G I   EF
Sbjct: 1   MAEIFESVDKNKDGKILWDEFAEAIRVFSPQITSEEIDKMFIVLDVDGDGQIDDVEF 57


>At2g15180.1 68415.m01731 zinc knuckle (CCHC-type) family protein
           contains Pfam domain PF00098: Zinc knuckle
          Length = 474

 Score = 27.5 bits (58), Expect = 7.2
 Identities = 13/50 (26%), Positives = 24/50 (48%)
 Frame = -1

Query: 277 PRDKQSKRVSPEDQ*LVS*HEHSFASALPPGRNQQTSVCATQLSSPFQLL 128
           P  + + +V  E Q L+   E     + P G+N+Q   C T L++   ++
Sbjct: 241 PTRETTTKVGLEQQELLKAKEKQEIVSSPKGKNEQAETCQTDLNNSMNVI 290


>At4g15415.2 68417.m02357 serine/threonine protein phosphatase 2A
           (PP2A) regulatory subunit B' (B'gamma) identical to B'
           regulatory subunit of PP2A [Arabidopsis thaliana]
           GI:2160694; similar to SWISS-PROT:Q28653
           serine/threonine protein phosphatase 2A, 56 kDa
           regulatory subunit, delta isoform (PP2A, B subunit, B'
           delta isoform, PP2A, B subunit, B56 delta isoform, PP2A,
           B subunit, PR61 delta isoform, PP2A, B subunit, R5 delta
           isoform, PP2A, B subunit, B'-gamma) [Oryctolagus
           cuniculus]; contains Pfam domain, PF01603: Protein
           phosphatase 2A regulatory B subunit (B56 family)
          Length = 522

 Score = 27.1 bits (57), Expect = 9.5
 Identities = 11/27 (40%), Positives = 18/27 (66%)
 Frame = -2

Query: 561 VIAPSPVLSSFLNACSTIYDAIPTWED 481
           VIAPS   S+  N  + +Y+A+P++ D
Sbjct: 61  VIAPSSTSSNRTNQVNGVYEALPSFRD 87


>At4g15415.1 68417.m02356 serine/threonine protein phosphatase 2A
           (PP2A) regulatory subunit B' (B'gamma) identical to B'
           regulatory subunit of PP2A [Arabidopsis thaliana]
           GI:2160694; similar to SWISS-PROT:Q28653
           serine/threonine protein phosphatase 2A, 56 kDa
           regulatory subunit, delta isoform (PP2A, B subunit, B'
           delta isoform, PP2A, B subunit, B56 delta isoform, PP2A,
           B subunit, PR61 delta isoform, PP2A, B subunit, R5 delta
           isoform, PP2A, B subunit, B'-gamma) [Oryctolagus
           cuniculus]; contains Pfam domain, PF01603: Protein
           phosphatase 2A regulatory B subunit (B56 family)
          Length = 522

 Score = 27.1 bits (57), Expect = 9.5
 Identities = 11/27 (40%), Positives = 18/27 (66%)
 Frame = -2

Query: 561 VIAPSPVLSSFLNACSTIYDAIPTWED 481
           VIAPS   S+  N  + +Y+A+P++ D
Sbjct: 61  VIAPSSTSSNRTNQVNGVYEALPSFRD 87


>At3g13380.1 68416.m01683 leucine-rich repeat family protein / protein
            kinase family protein contains Pfam domains PF00560:
            Leucine Rich Repeat and PF00069: Protein kinase domain
          Length = 1164

 Score = 27.1 bits (57), Expect = 9.5
 Identities = 15/29 (51%), Positives = 19/29 (65%)
 Frame = +3

Query: 423  QFDTDSSGSISLDEFLIKIRPPMSESRRK 509
            Q DT++    SLDEFL+K  P + ESR K
Sbjct: 1137 QVDTEND---SLDEFLLKETPLVEESRDK 1162


>At3g12720.1 68416.m01589 myb family transcription factor contains
           PFAM profile: PF00249 myb-like DNA binding domain
          Length = 307

 Score = 27.1 bits (57), Expect = 9.5
 Identities = 18/68 (26%), Positives = 36/68 (52%), Gaps = 2/68 (2%)
 Frame = +1

Query: 277 VLQGSWDLEEFSVAWMMMEVN--Y*TKKNSFMASRKQGWNLIKVKPKNSSVNSTQTVVAQ 450
           +++   DL++ + A+ +  +N    TK N   +  +       V P N +++STQT++  
Sbjct: 162 IMKNPTDLDQSTTAFSITNINPPTSTKPNKLKSPNQTTIPSQTVIPINDNMSSTQTMIPI 221

Query: 451 SVLMNSLL 474
           +  M+SLL
Sbjct: 222 NDPMSSLL 229


>At2g38910.1 68415.m04783 calcium-dependent protein kinase, putative
           / CDPK, putative similar to calcium-dependent protein
           kinase, isoform AK1 (CDPK) [Arabidopsis thaliana]
           SWISS-PROT:Q06850; contains protein kinase domain,
           Pfam:PF00069; contains EF hand domain (calcium-binding
           EF-hand), Pfam:PF00036, INTERPRO:IPR002048
          Length = 583

 Score = 27.1 bits (57), Expect = 9.5
 Identities = 10/19 (52%), Positives = 15/19 (78%)
 Frame = +3

Query: 408 EELFSQFDTDSSGSISLDE 464
           +E+F   DTD+SG I+L+E
Sbjct: 441 KEMFKMIDTDNSGHITLEE 459


>At2g35800.1 68415.m04396 mitochondrial substrate carrier family
           protein contains INTERPRO:IPR001993 Mitochondrial
           substrate carrier family, INTERPRO:IPR002048
           calcium-binding EF-hand domain
          Length = 823

 Score = 27.1 bits (57), Expect = 9.5
 Identities = 8/18 (44%), Positives = 16/18 (88%)
 Frame = +2

Query: 524 FKKLDKTGDGAITIDDIK 577
           F++LD+ GDG +T++D++
Sbjct: 383 FEELDRDGDGKVTLEDLE 400


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 12,043,566
Number of Sequences: 28952
Number of extensions: 237672
Number of successful extensions: 943
Number of sequences better than 10.0: 96
Number of HSP's better than 10.0 without gapping: 788
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 935
length of database: 12,070,560
effective HSP length: 77
effective length of database: 9,841,256
effective search space used: 1190791976
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).