BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0250.Seq (460 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g08230.1 68418.m00965 PWWP domain-containing protein putative... 29 1.1 At1g17380.1 68414.m02120 expressed protein 28 2.6 At5g05920.1 68418.m00654 deoxyhypusine synthase almost identical... 28 3.5 At3g61670.1 68416.m06911 expressed protein weak similarity to ex... 28 3.5 At4g18465.1 68417.m02740 RNA helicase, putative similar to SP|Q1... 27 8.1 >At5g08230.1 68418.m00965 PWWP domain-containing protein putative transcription factor (HUA2) - Arabidopsis thaliana, EMBL:AF116556 Length = 1445 Score = 29.5 bits (63), Expect = 1.1 Identities = 16/44 (36%), Positives = 22/44 (50%), Gaps = 1/44 (2%) Frame = -3 Query: 179 HCLEPPDSR-GSTVSISLPDSARLASALEAFRHNPADGXFAPPA 51 HCL PP + SI+LP S+ ++ + P FAPPA Sbjct: 1162 HCLPPPTAPLAPAQSIALPPSSITRPSMPSHPSLPLQPGFAPPA 1205 >At1g17380.1 68414.m02120 expressed protein Length = 274 Score = 28.3 bits (60), Expect = 2.6 Identities = 16/63 (25%), Positives = 33/63 (52%), Gaps = 1/63 (1%) Frame = -2 Query: 432 YESPGAGLSLNRSQHDAALPSTTPRQERKSSTDYSEPR-HRTELYPDFGAVMHVLRKKPI 256 ++ PG +++++ H PST+ + K D SE + ++L FG + V + P+ Sbjct: 56 FDPPGKQNAMHKAGHSKGEPSTSSGGKVKDVADLSESQPGSSQLTIFFGGKVLVYNEFPV 115 Query: 255 DRS 247 D++ Sbjct: 116 DKA 118 >At5g05920.1 68418.m00654 deoxyhypusine synthase almost identical to deoxyhypusine synthase GI:15431345 from [Arabidopsis thaliana] Length = 368 Score = 27.9 bits (59), Expect = 3.5 Identities = 18/47 (38%), Positives = 24/47 (51%), Gaps = 1/47 (2%) Frame = -1 Query: 427 ITWRRAESQQIAARRCSTEHNTPPGTEVVY-RLFRAPTSN*VISGLR 290 + WR A+ +A CS E P E V ++F TSN V SG+R Sbjct: 67 LDWRLADETTVA-EDCSEEEKNPSFRESVKCKIFLGFTSNLVSSGVR 112 >At3g61670.1 68416.m06911 expressed protein weak similarity to extra-large G-protein [Arabidopsis thaliana] GI:3201682 Length = 790 Score = 27.9 bits (59), Expect = 3.5 Identities = 18/76 (23%), Positives = 32/76 (42%) Frame = -2 Query: 435 NYESPGAGLSLNRSQHDAALPSTTPRQERKSSTDYSEPRHRTELYPDFGAVMHVLRKKPI 256 N++ GAG +RS+HD S + S + S + D+ + K Sbjct: 558 NHDRSGAGSRSSRSEHDKVTLSKATAMRQNSMKEVSLASEMEVNFNDYSHRNSGVSKDQQ 617 Query: 255 DRSPRSKWASTSRXAF 208 R+ +S +AS + +F Sbjct: 618 QRAKKSGFASIVKKSF 633 >At4g18465.1 68417.m02740 RNA helicase, putative similar to SP|Q14562 ATP-dependent helicase DDX8 (RNA helicase HRH1) (DEAH-box protein 8) {Homo sapiens}; contains Pfam profiles PF04408: Helicase associated domain (HA2), PF00271: Helicase conserved C-terminal domain Length = 704 Score = 26.6 bits (56), Expect = 8.1 Identities = 18/59 (30%), Positives = 26/59 (44%) Frame = +2 Query: 155 ESREALNNVTLLVAFRIQNAXRDVEAHLDRGDRSIGFFLNTCITAPKSGYNSVRCRGSE 331 E R+ L + + +++ D+EA R + GFF N C P S RGSE Sbjct: 589 EIRDQLKRIARRLGITLKSCDGDMEAV--RKAVTAGFFANACRLEPHSNGVYKTIRGSE 645 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,405,568 Number of Sequences: 28952 Number of extensions: 173834 Number of successful extensions: 447 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 438 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 447 length of database: 12,070,560 effective HSP length: 75 effective length of database: 9,899,160 effective search space used: 762235320 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -