BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0237.Seq (907 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g12710.1 68416.m01588 methyladenine glycosylase family protei... 66 2e-11 At5g44680.1 68418.m05474 methyladenine glycosylase family protei... 64 2e-10 At1g15970.1 68414.m01916 methyladenine glycosylase family protei... 62 6e-10 At5g57970.1 68418.m07253 methyladenine glycosylase family protei... 58 1e-08 At1g80850.1 68414.m09485 methyladenine glycosylase family protei... 56 4e-08 At1g75090.1 68414.m08721 methyladenine glycosylase family protei... 55 6e-08 At1g13635.1 68414.m01602 methyladenine glycosylase family protei... 52 5e-07 At2g07240.1 68415.m00831 Ulp1 protease family protein contains P... 33 0.26 At1g69600.1 68414.m08005 zinc finger homeobox family protein / Z... 32 0.45 At1g79800.1 68414.m09316 plastocyanin-like domain-containing pro... 29 3.2 At4g30860.1 68417.m04381 SET domain-containing protein low simil... 29 5.6 At1g42460.1 68414.m04896 Ulp1 protease family protein contains P... 29 5.6 At5g58320.2 68418.m07301 kinase interacting protein-related low ... 28 9.8 At5g58320.1 68418.m07300 kinase interacting protein-related low ... 28 9.8 At5g38700.1 68418.m04679 expressed protein 28 9.8 At3g48730.1 68416.m05321 glutamate-1-semialdehyde 2,1-aminomutas... 28 9.8 At1g15210.1 68414.m01818 ABC transporter family protein Similar ... 28 9.8 >At3g12710.1 68416.m01588 methyladenine glycosylase family protein similar to SP|P05100 DNA-3-methyladenine glycosylase I (EC 3.2.2.20) (3-methyladenine-DNA glycosylase I, constitutive) {Escherichia coli}; contains Pfam profile PF03352: Methyladenine glycosylase Length = 312 Score = 66.5 bits (155), Expect = 2e-11 Identities = 26/47 (55%), Positives = 37/47 (78%) Frame = +1 Query: 25 EIPTSTSASDALSKALKKRGFKFVGTTICYSFMQACGLVNDHVVGCC 165 +IP TS S+++SK + +RGF+FVG T+ +SFMQA GL NDH++ CC Sbjct: 254 KIPVKTSKSESISKDMVRRGFRFVGPTVVHSFMQAAGLTNDHLITCC 300 >At5g44680.1 68418.m05474 methyladenine glycosylase family protein similar to SP|P05100 DNA-3-methyladenine glycosylase I (EC 3.2.2.20) (3-methyladenine-DNA glycosylase I, constitutive) {Escherichia coli}; contains Pfam profile PF03352: Methyladenine glycosylase Length = 353 Score = 63.7 bits (148), Expect = 2e-10 Identities = 26/53 (49%), Positives = 38/53 (71%) Frame = +1 Query: 4 TQATTLSEIPTSTSASDALSKALKKRGFKFVGTTICYSFMQACGLVNDHVVGC 162 T+ T+ +IP TS S+ +SK + +RGF+FVG T+ +S MQA GL NDH++ C Sbjct: 289 TKYTSCQKIPVKTSKSETISKDMVRRGFRFVGPTVIHSLMQAAGLTNDHLITC 341 >At1g15970.1 68414.m01916 methyladenine glycosylase family protein similar to SP|P05100 DNA-3-methyladenine glycosylase I (EC 3.2.2.20) (3-methyladenine-DNA glycosylase I, constitutive) {Escherichia coli}; contains Pfam profile PF03352: Methyladenine glycosylase Length = 352 Score = 61.7 bits (143), Expect = 6e-10 Identities = 25/49 (51%), Positives = 35/49 (71%) Frame = +1 Query: 25 EIPTSTSASDALSKALKKRGFKFVGTTICYSFMQACGLVNDHVVGCCCY 171 ++P TS ++ +SK L +RGF+ V T+ YSFMQA GL NDH++GC Y Sbjct: 279 QVPVKTSKAEFISKDLVRRGFRSVSPTVIYSFMQAAGLTNDHLIGCFRY 327 >At5g57970.1 68418.m07253 methyladenine glycosylase family protein similar to SP|P05100 DNA-3-methyladenine glycosylase I (EC 3.2.2.20) (3-methyladenine-DNA glycosylase I, constitutive) {Escherichia coli}; contains Pfam profile PF03352: Methyladenine glycosylase Length = 347 Score = 57.6 bits (133), Expect = 1e-08 Identities = 22/46 (47%), Positives = 32/46 (69%) Frame = +1 Query: 25 EIPTSTSASDALSKALKKRGFKFVGTTICYSFMQACGLVNDHVVGC 162 ++P T ++ +SK L +RGF+ VG T+ YSFMQA G+ NDH+ C Sbjct: 288 QVPAKTPKAEVISKDLVRRGFRSVGPTVVYSFMQAAGITNDHLTSC 333 >At1g80850.1 68414.m09485 methyladenine glycosylase family protein similar to SP|P05100 DNA-3-methyladenine glycosylase I (EC 3.2.2.20) (3-methyladenine-DNA glycosylase I, constitutive) {Escherichia coli}; contains Pfam profile PF03352: Methyladenine glycosylase Length = 327 Score = 55.6 bits (128), Expect = 4e-08 Identities = 23/49 (46%), Positives = 33/49 (67%) Frame = +1 Query: 25 EIPTSTSASDALSKALKKRGFKFVGTTICYSFMQACGLVNDHVVGCCCY 171 ++P TS ++ +SK L +RGF+ V T+ YSFMQ GL NDH+ CC+ Sbjct: 268 QVPVKTSKAELISKDLVRRGFRSVSPTVIYSFMQTAGLTNDHLT--CCF 314 >At1g75090.1 68414.m08721 methyladenine glycosylase family protein similar to SP|P05100 DNA-3-methyladenine glycosylase I (EC 3.2.2.20) (3-methyladenine-DNA glycosylase I, constitutive) {Escherichia coli}; contains Pfam profile PF03352: Methyladenine glycosylase Length = 329 Score = 55.2 bits (127), Expect = 6e-08 Identities = 21/49 (42%), Positives = 34/49 (69%) Frame = +1 Query: 25 EIPTSTSASDALSKALKKRGFKFVGTTICYSFMQACGLVNDHVVGCCCY 171 ++P + ++ +SK + +RGF+ VG T+ YSF+QA G+VNDH+ C Y Sbjct: 253 QVPVKSPKAEYISKDMMQRGFRCVGPTVMYSFLQASGIVNDHLTACFRY 301 >At1g13635.1 68414.m01602 methyladenine glycosylase family protein Contains Pfam profile PF03352: Methyladenine glycosylase Length = 311 Score = 52.0 bits (119), Expect = 5e-07 Identities = 22/45 (48%), Positives = 31/45 (68%) Frame = +1 Query: 28 IPTSTSASDALSKALKKRGFKFVGTTICYSFMQACGLVNDHVVGC 162 +P + ++ +SK + KRGF+FVG I +SFMQA GL DH+V C Sbjct: 250 VPLRSPKAEIISKDMIKRGFRFVGPVIVHSFMQAAGLTIDHLVDC 294 >At2g07240.1 68415.m00831 Ulp1 protease family protein contains Pfam profile PF02902: Ulp1 protease family, C-terminal catalytic domain Length = 928 Score = 33.1 bits (72), Expect = 0.26 Identities = 30/103 (29%), Positives = 43/103 (41%), Gaps = 4/103 (3%) Frame = -1 Query: 505 FFDKPPASGGDGAAAHTASAPYQYRPDGLRCDKHRCQKS----AFHNADKTEKLTVFFPD 338 FF+ PP SGG A P G + + R S FH DK KL V P Sbjct: 605 FFNPPPPSGGKLLAGKDGGGPDGDVNQGRKSKRPRTLSSKLDGRFH-FDKKTKLLVGHPS 663 Query: 337 PVLRVGKIGIPHQRNAVTPVIRFYKGMPQVVLSSHSSRIAGSS 209 P L VG++ A P +R+ + + ++ S S + +S Sbjct: 664 PFLSVGEL-------ASDPEVRYQRSLSKIKGKSSISIVGEAS 699 >At1g69600.1 68414.m08005 zinc finger homeobox family protein / ZF-HD homeobox family protein Length = 242 Score = 32.3 bits (70), Expect = 0.45 Identities = 23/78 (29%), Positives = 32/78 (41%), Gaps = 2/78 (2%) Frame = -1 Query: 430 PDGLRCDKHRCQKSAFHNADKTEKLTVFFPDPVLRVGKIGIPHQRNAVTPVIRFY--KGM 257 P LRC C ++ FH D +E L P+ P R+ +PV Y Sbjct: 64 PSSLRCAACGCHRN-FHRRDPSENLNFLTAPPISSPSGTESPPSRHVSSPVPCSYYTSAP 122 Query: 256 PQVVLSSHSSRIAGSSER 203 P V+ S SS G S++ Sbjct: 123 PHHVILSLSSGFPGPSDQ 140 >At1g79800.1 68414.m09316 plastocyanin-like domain-containing protein Length = 192 Score = 29.5 bits (63), Expect = 3.2 Identities = 28/96 (29%), Positives = 37/96 (38%), Gaps = 2/96 (2%) Frame = -1 Query: 406 HRCQKSAFHNADKTEKLTVFFPDPVLRVGKIGIPHQRNAVTPVIRFYKGMPQVVLSSHSS 227 H + FH D V+ D V+ V K G H N P+ F G L Sbjct: 55 HWASSNRFHIGDSLS--FVYDKDSVMEVDKWGFYHC-NGSDPITAFDNGNSTFDLDRPGL 111 Query: 226 R--IAGSSERCASRIMVYFPDSNSSQPHDHSPAHMP 125 I+GS++ C S + + Q HDH A MP Sbjct: 112 FYFISGSNQHCTSGQRLIVEVMHIHQHHDHD-ASMP 146 >At4g30860.1 68417.m04381 SET domain-containing protein low similarity to IL-5 promoter REII-region-binding protein [Homo sapiens] GI:12642795; contains Pfam profile PF00856: SET domain Length = 497 Score = 28.7 bits (61), Expect = 5.6 Identities = 14/44 (31%), Positives = 22/44 (50%), Gaps = 2/44 (4%) Frame = +1 Query: 157 GCCCYP--GNKP*FGKRNVQNSPRSSNCGWKVQPGASLYKSELL 282 GC C GN+P F K ++ +CGW V+ S+ K + + Sbjct: 310 GCSCPESCGNRP-FRKEKKIKIVKTEHCGWGVEAAESINKEDFI 352 >At1g42460.1 68414.m04896 Ulp1 protease family protein contains Pfam profile PF02902: Ulp1 protease family, C-terminal catalytic domain Length = 762 Score = 28.7 bits (61), Expect = 5.6 Identities = 22/69 (31%), Positives = 29/69 (42%), Gaps = 4/69 (5%) Frame = -1 Query: 508 DFFDKPPASGGDGAAAHTASAPYQYRPDGLRCDKHRCQKS----AFHNADKTEKLTVFFP 341 DF +PPASGG + G + + R S FH DK KL V P Sbjct: 480 DFSTRPPASGGKLTSGKDVGGIDVDVNQGRKSKRPRTLSSKLDGQFH-FDKKPKLLVGHP 538 Query: 340 DPVLRVGKI 314 P+L G++ Sbjct: 539 SPLLSAGEV 547 >At5g58320.2 68418.m07301 kinase interacting protein-related low similarity to kinase interacting protein 1 [Petunia integrifolia] GI:13936326 Length = 558 Score = 27.9 bits (59), Expect = 9.8 Identities = 21/55 (38%), Positives = 27/55 (49%) Frame = +3 Query: 270 KRITGVTAFRWCGMPILPTRKTGSGKKTVSFSVLSALWKADFWQRCLSHRRPSGR 434 +R +T G P L + GSG +S S LSALW ++ R R PSGR Sbjct: 92 ERYENITGELRKGSP-LELQSQGSGLSDISASDLSALWTSNEVNRL--GRPPSGR 143 >At5g58320.1 68418.m07300 kinase interacting protein-related low similarity to kinase interacting protein 1 [Petunia integrifolia] GI:13936326 Length = 490 Score = 27.9 bits (59), Expect = 9.8 Identities = 21/55 (38%), Positives = 27/55 (49%) Frame = +3 Query: 270 KRITGVTAFRWCGMPILPTRKTGSGKKTVSFSVLSALWKADFWQRCLSHRRPSGR 434 +R +T G P L + GSG +S S LSALW ++ R R PSGR Sbjct: 92 ERYENITGELRKGSP-LELQSQGSGLSDISASDLSALWTSNEVNRL--GRPPSGR 143 >At5g38700.1 68418.m04679 expressed protein Length = 161 Score = 27.9 bits (59), Expect = 9.8 Identities = 10/29 (34%), Positives = 17/29 (58%) Frame = -3 Query: 692 WGMAVRVIRRWHGWKNTTVRN*HLQRLNH 606 WG + +RWH ++ + + HL+ LNH Sbjct: 5 WGRKGGIFKRWHMFELRNLFSKHLKALNH 33 >At3g48730.1 68416.m05321 glutamate-1-semialdehyde 2,1-aminomutase 2 (GSA 2) / glutamate-1-semialdehyde aminotransferase 2 (GSA-AT 2) identical to GSA2 [SP|Q42522] Length = 472 Score = 27.9 bits (59), Expect = 9.8 Identities = 22/88 (25%), Positives = 35/88 (39%) Frame = -1 Query: 484 SGGDGAAAHTASAPYQYRPDGLRCDKHRCQKSAFHNADKTEKLTVFFPDPVLRVGKIGIP 305 +G A + SA + R RC K + +KT+K T+ + K +P Sbjct: 6 TGSGIALGFSCSAKFSKRASS--SSNRRCIKMSVSVEEKTKKFTLQKSEEAFNAAKNLMP 63 Query: 304 HQRNAVTPVIRFYKGMPQVVLSSHSSRI 221 N+ + G P V+ S+ SRI Sbjct: 64 GGVNSPVRAFKSVGGQPVVMDSAKGSRI 91 >At1g15210.1 68414.m01818 ABC transporter family protein Similar to gb|Z70524 GI:1514643 PDR5-like ABC transporter from Spirodela polyrrhiza and is a member of the PF|00005 ABC transporter family. ESTs gb|N97039 and gb|T43169 come from this gene Length = 1442 Score = 27.9 bits (59), Expect = 9.8 Identities = 12/26 (46%), Positives = 14/26 (53%) Frame = +2 Query: 329 QNWVWEEDGKLLGFVSIMEGRFLAAM 406 +NW W G LLGF I G F A+ Sbjct: 764 KNWYWIGVGGLLGFTVIFNGFFTLAL 789 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 22,205,994 Number of Sequences: 28952 Number of extensions: 523917 Number of successful extensions: 1318 Number of sequences better than 10.0: 17 Number of HSP's better than 10.0 without gapping: 1237 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1317 length of database: 12,070,560 effective HSP length: 81 effective length of database: 9,725,448 effective search space used: 2139598560 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -