BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0231.Seq (683 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g70520.1 68414.m08116 protein kinase family protein contains ... 31 0.71 At3g28730.1 68416.m03587 structure-specific recognition protein ... 29 2.9 At1g34370.2 68414.m04268 zinc finger (C2H2 type) family protein ... 28 6.6 At1g34370.1 68414.m04267 zinc finger (C2H2 type) family protein ... 28 6.6 At5g38780.1 68418.m04689 S-adenosyl-L-methionine:carboxyl methyl... 27 8.8 At3g44340.1 68416.m04764 sec23/sec24 transport family protein co... 27 8.8 At2g24762.1 68415.m02958 expressed protein 27 8.8 At1g31820.1 68414.m03908 amino acid permease family protein weak... 27 8.8 >At1g70520.1 68414.m08116 protein kinase family protein contains Pfam domain, PF00069: Protein kinase domain Length = 649 Score = 31.1 bits (67), Expect = 0.71 Identities = 38/136 (27%), Positives = 54/136 (39%), Gaps = 16/136 (11%) Frame = +2 Query: 32 RILFDHLILHSRNYRVHLHGRGGSNQ--CVVPERPGSVLME--QQGSGNIISEDSGQFGY 199 RI D + + NY + +G + C R + +QG N ++E SG GY Sbjct: 119 RIFLDGCFMRAENYSFYNEYKGPEDSIVCGNTTRKNKTFGDAVRQGLRNAVTEASGTGGY 178 Query: 200 -------GRKESNHSFYRA---RVLL-QFCSKLLRSIKPSFVSAILIISELNSLHGASWV 346 G ES +F A R L C + L + S V L SE +LH ++ Sbjct: 179 ARASAKAGESESESAFVLANCWRTLSPDSCKQCLENASASVVKGCLPWSEGRALHTGCFL 238 Query: 347 SVSRED-TNKATFCGR 391 S +D NK GR Sbjct: 239 RYSDQDFLNKIPRNGR 254 >At3g28730.1 68416.m03587 structure-specific recognition protein 1 / high mobility group protein / HMG protein nearly identical to SP|Q05153 Structure-specific recognition protein 1 homolog (HMG protein) {Arabidopsis thaliana}; contains Pfam profile PF00505: HMG (high mobility group) box; contains Pfam profile PF03531: Structure-specific recognition protein Length = 646 Score = 29.1 bits (62), Expect = 2.9 Identities = 14/41 (34%), Positives = 21/41 (51%) Frame = +2 Query: 59 HSRNYRVHLHGRGGSNQCVVPERPGSVLMEQQGSGNIISED 181 HS N + L GRGG N ++ G + ++QG G + D Sbjct: 5 HSFN-NISLSGRGGKNPGLLKINSGGIQWKKQGGGKAVEVD 44 >At1g34370.2 68414.m04268 zinc finger (C2H2 type) family protein contains Pfam domain, PF00096: Zinc finger, C2H2 type Length = 499 Score = 27.9 bits (59), Expect = 6.6 Identities = 9/19 (47%), Positives = 12/19 (63%) Frame = -1 Query: 419 ASLPMFLRXCGRRRWLCSC 363 A L + CG+ +WLCSC Sbjct: 347 ADLKTHEKHCGKNKWLCSC 365 >At1g34370.1 68414.m04267 zinc finger (C2H2 type) family protein contains Pfam domain, PF00096: Zinc finger, C2H2 type Length = 499 Score = 27.9 bits (59), Expect = 6.6 Identities = 9/19 (47%), Positives = 12/19 (63%) Frame = -1 Query: 419 ASLPMFLRXCGRRRWLCSC 363 A L + CG+ +WLCSC Sbjct: 347 ADLKTHEKHCGKNKWLCSC 365 >At5g38780.1 68418.m04689 S-adenosyl-L-methionine:carboxyl methyltransferase family protein similar to defense-related protein cjs1 [Brassica carinata][GI:14009292], caffeine synthase [Camellia sinensis][GI:9967143], SAM:benzoic acid carboxyl methyltransferase [Antirrhinum majus][GI:9789277] Length = 361 Score = 27.5 bits (58), Expect = 8.8 Identities = 12/26 (46%), Positives = 15/26 (57%), Gaps = 1/26 (3%) Frame = +3 Query: 189 NLDTAGKNP-IIRFTVPEFSCSFVPN 263 NLD NP + FT+ +F CS PN Sbjct: 44 NLDLLNMNPNLSTFTIADFGCSIGPN 69 >At3g44340.1 68416.m04764 sec23/sec24 transport family protein contains Pfam domains PF04811: Sec23/Sec24 trunk domain, PF04815: Sec23/Sec24 helical domain and PF04810: Sec23/Sec24 zinc finger Length = 1096 Score = 27.5 bits (58), Expect = 8.8 Identities = 10/31 (32%), Positives = 19/31 (61%) Frame = +1 Query: 199 RQERIQSFVLPCQSSLAVLFQIVEIDKTFFC 291 R+ R+ + +PC + L+ LF+ ++D F C Sbjct: 822 RRIRVLNLSIPCTNMLSNLFRSADLDSQFAC 852 >At2g24762.1 68415.m02958 expressed protein Length = 156 Score = 27.5 bits (58), Expect = 8.8 Identities = 17/49 (34%), Positives = 25/49 (51%), Gaps = 2/49 (4%) Frame = -1 Query: 509 SGQSDIYRSESKSIIRSAVGASPEDVLVL--GASLPMFLRXCGRRRWLC 369 SG+ ES+S +++A A E VLV+ G LP FL + +C Sbjct: 72 SGERVDEEKESRSGVKAASAACEEKVLVIMAGDDLPRFLATPAANKCMC 120 >At1g31820.1 68414.m03908 amino acid permease family protein weak similarity to asc-type amino acid transporter 2 [Mus musculus] GI:18148438; contains Pfam profile PF00324: Amino acid permease Length = 482 Score = 27.5 bits (58), Expect = 8.8 Identities = 12/38 (31%), Positives = 18/38 (47%) Frame = +2 Query: 131 GSVLMEQQGSGNIISEDSGQFGYGRKESNHSFYRARVL 244 G M + GN+ +D G G KE N+S + +L Sbjct: 2 GDYNMNEFAYGNLYDDDDGDVGGSSKEGNNSIQKVSML 39 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,896,173 Number of Sequences: 28952 Number of extensions: 283117 Number of successful extensions: 761 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 735 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 761 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1447936096 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -