BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0229.Seq (901 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g34980.1 68417.m04959 subtilase family protein similar to SBT... 28 9.7 At4g11690.1 68417.m01867 pentatricopeptide (PPR) repeat-containi... 28 9.7 >At4g34980.1 68417.m04959 subtilase family protein similar to SBT1, a subtilase from tomato plants GI:1771160 from [Lycopersicon esculentum] Length = 764 Score = 27.9 bits (59), Expect = 9.7 Identities = 20/61 (32%), Positives = 30/61 (49%) Frame = -2 Query: 798 SVYSLDLIKGFCDFGLFG*KMS*FNKNLTRILTKY*RLQFAIRPFQXRNCWERAIGAGLF 619 S Y D+I G D G++ + S + NL I ++ + + F RNC + IGA F Sbjct: 119 SDYGSDVIIGVFDTGIWPERRSFSDLNLGPIPKRWRGVCESGARFSPRNCNRKIIGARFF 178 Query: 618 A 616 A Sbjct: 179 A 179 >At4g11690.1 68417.m01867 pentatricopeptide (PPR) repeat-containing protein contains Pfam profile PF01535: PPR repeat Length = 566 Score = 27.9 bits (59), Expect = 9.7 Identities = 14/33 (42%), Positives = 18/33 (54%), Gaps = 1/33 (3%) Frame = -2 Query: 849 FNSGLLFXNWNNTSTLISVYSLD-LIKGFCDFG 754 FN F N N + ++ VYS LIKG C+ G Sbjct: 145 FNQWWSFFNENKSKVVLDVYSFGILIKGCCEAG 177 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,855,381 Number of Sequences: 28952 Number of extensions: 380995 Number of successful extensions: 910 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 888 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 910 length of database: 12,070,560 effective HSP length: 81 effective length of database: 9,725,448 effective search space used: 2120147664 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -