BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0222.Seq (357 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g43930.1 68415.m05460 protein kinase family protein contains ... 27 4.9 At1g17110.1 68414.m02085 ubiquitin-specific protease 15 (UBP15) ... 26 6.4 At4g10890.1 68417.m01772 expressed protein 26 8.5 At3g62400.2 68416.m07010 expressed protein cytochrome c oxidase ... 26 8.5 At3g62400.1 68416.m07009 expressed protein cytochrome c oxidase ... 26 8.5 At1g19110.1 68414.m02377 inter-alpha-trypsin inhibitor heavy cha... 26 8.5 At1g06150.1 68414.m00646 pentatricopeptide (PPR) repeat-containi... 26 8.5 >At2g43930.1 68415.m05460 protein kinase family protein contains similarity to NPK1-related protein kinase 2 GI:2342425 from [Arabidopsis thaliana] Length = 204 Score = 26.6 bits (56), Expect = 4.9 Identities = 12/28 (42%), Positives = 14/28 (50%) Frame = +1 Query: 250 EPDHILLFHARNIQAAFLARFEHSNLFK 333 EP +LL R F + FEH LFK Sbjct: 63 EPHIVLLLQCRKKSWCFASEFEHLKLFK 90 >At1g17110.1 68414.m02085 ubiquitin-specific protease 15 (UBP15) almost identical to ubiquitin-specific protease 15 GI:11993475 [Arabidopsis thaliana], 7 amino acid difference Length = 924 Score = 26.2 bits (55), Expect = 6.4 Identities = 9/26 (34%), Positives = 15/26 (57%) Frame = -2 Query: 146 NXSESICQRCFHQSRTKXRGSKAIRY 69 N +C RCF ++T+ K++RY Sbjct: 124 NNELHVCARCFGPAKTRCSRCKSVRY 149 >At4g10890.1 68417.m01772 expressed protein Length = 527 Score = 25.8 bits (54), Expect = 8.5 Identities = 12/40 (30%), Positives = 20/40 (50%), Gaps = 1/40 (2%) Frame = -2 Query: 155 RKTNXSESICQRCFHQS-RTKXRGSKAIRYRPSSNRKYVI 39 ++T +C RC+H S R K R S R S++ ++ Sbjct: 194 KQTKICSRVCSRCYHYSMRQKLRHSLHTRILKSNSENAIL 233 >At3g62400.2 68416.m07010 expressed protein cytochrome c oxidase subunit 5c - Oryza sativa, EMBL:AB027123 Length = 86 Score = 25.8 bits (54), Expect = 8.5 Identities = 10/22 (45%), Positives = 16/22 (72%) Frame = +2 Query: 167 ISPLTSQYECXQLSLLIITSEF 232 +SPL S++EC L+L ++ S F Sbjct: 20 LSPLKSEWECLSLTLNVVGSIF 41 >At3g62400.1 68416.m07009 expressed protein cytochrome c oxidase subunit 5c - Oryza sativa, EMBL:AB027123 Length = 86 Score = 25.8 bits (54), Expect = 8.5 Identities = 10/22 (45%), Positives = 16/22 (72%) Frame = +2 Query: 167 ISPLTSQYECXQLSLLIITSEF 232 +SPL S++EC L+L ++ S F Sbjct: 20 LSPLKSEWECLSLTLNVVGSIF 41 >At1g19110.1 68414.m02377 inter-alpha-trypsin inhibitor heavy chain-related similar to SP|Q61704 Inter-alpha-trypsin inhibitor heavy chain H3 precursor {Mus musculus}; contains Pfam profile PF00092: von Willebrand factor type A domain Length = 754 Score = 25.8 bits (54), Expect = 8.5 Identities = 11/41 (26%), Positives = 21/41 (51%) Frame = -2 Query: 191 RIATLEVKFLDRRKTNXSESICQRCFHQSRTKXRGSKAIRY 69 +I+ E +L +E +C+ C HQ + K R + +R+ Sbjct: 225 KISKREKIYLSVNAGTGTEVLCKGCSHQLKEKLRSAGKLRF 265 >At1g06150.1 68414.m00646 pentatricopeptide (PPR) repeat-containing protein contains Pfam profile PF01535: PPR repeat Length = 1322 Score = 25.8 bits (54), Expect = 8.5 Identities = 9/34 (26%), Positives = 19/34 (55%) Frame = -2 Query: 212 IGITGXIRIATLEVKFLDRRKTNXSESICQRCFH 111 + I G +++ ++ V+ LD+ E +C+ C H Sbjct: 640 VEIGGHLQVCSIMVENLDKEGVMLIEMLCEECSH 673 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 6,597,360 Number of Sequences: 28952 Number of extensions: 103705 Number of successful extensions: 196 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 195 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 196 length of database: 12,070,560 effective HSP length: 72 effective length of database: 9,986,016 effective search space used: 459356736 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -