SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ps4M0221.Seq
         (907 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At3g25510.1 68416.m03172 disease resistance protein (TIR-NBS-LRR...    30   2.4  

>At3g25510.1 68416.m03172 disease resistance protein (TIR-NBS-LRR
           class), putative domain signature TIR-NBS-LRR exists,
           suggestive of a disease resistance protein.
          Length = 1981

 Score = 29.9 bits (64), Expect = 2.4
 Identities = 16/40 (40%), Positives = 20/40 (50%)
 Frame = +1

Query: 160 TLTGDFKGHQENRNGDLVTGSYSVVDPDGTRRSWIIQLTP 279
           TL   FK  Q+NR  D  + S S V P    R+W  Q+ P
Sbjct: 18  TLLKKFKFQQDNREDDSASLSPSSVPPSSLSRTWKHQVFP 57


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 15,128,210
Number of Sequences: 28952
Number of extensions: 253813
Number of successful extensions: 513
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 502
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 513
length of database: 12,070,560
effective HSP length: 81
effective length of database: 9,725,448
effective search space used: 2139598560
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -