BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0206.Seq (840 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g04955.1 68417.m00720 amidohydrolase family protein similar t... 37 0.019 At3g49200.1 68416.m05377 hypothetical protein 28 6.7 >At4g04955.1 68417.m00720 amidohydrolase family protein similar to SP|P32375 Allantoinase (EC 3.5.2.5) {Saccharomyces cerevisiae}; contains Pfam profile PF01979: Amidohydrolase family Length = 506 Score = 36.7 bits (81), Expect = 0.019 Identities = 17/42 (40%), Positives = 26/42 (61%), Gaps = 1/42 (2%) Frame = -2 Query: 377 VHICHVARKEEIL-IIKAAKERGVKVTCEVCPHHLFLNSNDI 255 +HI H++ L +IK AK +G VT E CPH+L ++ +I Sbjct: 288 LHIVHLSDASSSLDLIKEAKGKGDSVTVETCPHYLAFSAEEI 329 Score = 33.1 bits (72), Expect = 0.24 Identities = 12/21 (57%), Positives = 16/21 (76%) Frame = -3 Query: 835 HGNIVKLPGFIDVHVHVREPG 773 +G V +PG IDVHVH+ +PG Sbjct: 92 YGEAVLMPGLIDVHVHLDDPG 112 >At3g49200.1 68416.m05377 hypothetical protein Length = 507 Score = 28.3 bits (60), Expect = 6.7 Identities = 10/29 (34%), Positives = 21/29 (72%) Frame = +3 Query: 618 HRALTLANVEA*SNAVRSTIEGLVLGIAQ 704 HR ++L +++ NA++ T+ +VLG++Q Sbjct: 266 HRTVSLDDIKLIKNAMKMTVNDVVLGVSQ 294 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,644,176 Number of Sequences: 28952 Number of extensions: 356130 Number of successful extensions: 926 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 895 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 926 length of database: 12,070,560 effective HSP length: 80 effective length of database: 9,754,400 effective search space used: 1941125600 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -