BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0147.Seq (598 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g42920.1 68415.m05318 pentatricopeptide (PPR) repeat-containi... 27 7.2 At4g21810.1 68417.m03155 Der1-like family protein / degradation ... 27 9.5 >At2g42920.1 68415.m05318 pentatricopeptide (PPR) repeat-containing protein and genefinder Length = 559 Score = 27.5 bits (58), Expect = 7.2 Identities = 10/22 (45%), Positives = 15/22 (68%) Frame = -2 Query: 465 VKLQLCEQDTVFWSVVFTSCRK 400 +K E+DTV WS + ++CRK Sbjct: 418 IKNMPVEEDTVIWSSLLSACRK 439 >At4g21810.1 68417.m03155 Der1-like family protein / degradation in the ER-like family protein contains Pfam profile: PF04511 Der1-like family Length = 244 Score = 27.1 bits (57), Expect = 9.5 Identities = 10/45 (22%), Positives = 22/45 (48%) Frame = -3 Query: 293 FKFYIVPVLLLSLYNLCRQSITLVFI*KVFFFYLFNFIYIKIFCK 159 + Y+ P L++ Y R ++ K+ +LF+ ++ +CK Sbjct: 38 YNLYLNPTLVVKQYQFWRLVTNFLYFRKMDLDFLFHMFFLARYCK 82 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,580,221 Number of Sequences: 28952 Number of extensions: 176128 Number of successful extensions: 309 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 304 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 309 length of database: 12,070,560 effective HSP length: 77 effective length of database: 9,841,256 effective search space used: 1190791976 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -