SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fbVf0113
         (659 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At2g07020.1 68415.m00803 protein kinase family protein contains ...    29   2.7  
At3g05660.1 68416.m00630 disease resistance family protein conta...    28   4.8  
At4g38560.1 68417.m05459 expressed protein                             28   6.3  
At1g22760.1 68414.m02844 polyadenylate-binding protein 3 (PABP3)       27   8.4  

>At2g07020.1 68415.m00803 protein kinase family protein contains
           protein kinase domain, Pfam:PF00069
          Length = 700

 Score = 29.1 bits (62), Expect = 2.7
 Identities = 15/37 (40%), Positives = 21/37 (56%), Gaps = 1/37 (2%)
 Frame = -3

Query: 270 QKLSRSSKLT-TSHARPSVDWF*SNKSTHPITGQSSD 163
           Q L   S L+  S  RPS+DWF  N+S +  +  SS+
Sbjct: 218 QALVSDSDLSFVSSDRPSMDWFEDNRSNYATSSSSSE 254


>At3g05660.1 68416.m00630 disease resistance family protein contains
           leucine rich-repeat (LRR) domains Pfam:PF00560,
           INTERPRO:IPR001611; similar to Cf-2.2 [Lycopersicon
           pimpinellifolium] gi|1184077|gb|AAC15780
          Length = 883

 Score = 28.3 bits (60), Expect = 4.8
 Identities = 14/41 (34%), Positives = 19/41 (46%)
 Frame = +2

Query: 191 VLLLDQNQSTEGLACEVVNFDDLDNFCRSHGQVPATHLSNV 313
           +L LD N+ +  L  EV+N   L     SH Q   T   N+
Sbjct: 211 ILRLDNNKLSGNLPLEVINLTKLSEISLSHNQFTGTLPPNI 251


>At4g38560.1 68417.m05459 expressed protein
          Length = 521

 Score = 27.9 bits (59), Expect = 6.3
 Identities = 15/48 (31%), Positives = 25/48 (52%)
 Frame = +1

Query: 10  SYMLVSKIKPCMSQCKPY*GDTANGSIYQFWFLRSYSVTWITVVILEL 153
           SY + + +   + +     GD A+GS  Q    +SYS+  +  V+LEL
Sbjct: 341 SYKVRASVSSTLQKILDKHGDIASGSKLQSLRTKSYSLETLAAVVLEL 388


>At1g22760.1 68414.m02844 polyadenylate-binding protein 3 (PABP3)
          Length = 660

 Score = 27.5 bits (58), Expect = 8.4
 Identities = 12/30 (40%), Positives = 18/30 (60%)
 Frame = +3

Query: 372 GIKVRFRRGSLRNGYHIQGRQQARKLPTPG 461
           G ++ FRRG+     HIQ +Q   + P+PG
Sbjct: 497 GPRMGFRRGATNVQQHIQQQQLMHRNPSPG 526


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 13,960,030
Number of Sequences: 28952
Number of extensions: 294450
Number of successful extensions: 632
Number of sequences better than 10.0: 4
Number of HSP's better than 10.0 without gapping: 617
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 632
length of database: 12,070,560
effective HSP length: 78
effective length of database: 9,812,304
effective search space used: 1383534864
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).