SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fbVf0112
         (679 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At3g52160.1 68416.m05726 beta-ketoacyl-CoA synthase family prote...    29   3.7  
At3g44800.1 68416.m04826 meprin and TRAF homology domain-contain...    28   4.9  
At1g67970.1 68414.m07764 heat shock factor protein, putative (HS...    27   8.6  
At1g06460.1 68414.m00684 31.2 kDa small heat shock family protei...    27   8.6  

>At3g52160.1 68416.m05726 beta-ketoacyl-CoA synthase family protein
           beta-ketoacyl-CoA synthase - Simmondsia
           chinensis,PID:g1045614
          Length = 451

 Score = 28.7 bits (61), Expect = 3.7
 Identities = 11/27 (40%), Positives = 18/27 (66%)
 Frame = -1

Query: 664 RAKAGLIQMFSTHRDCESTAYRSFSIK 584
           RAK  L+Q+  TH+  E T+Y+S  ++
Sbjct: 291 RAKYQLMQLVRTHKGMEDTSYKSIELR 317


>At3g44800.1 68416.m04826 meprin and TRAF homology domain-containing
           protein / MATH domain-containing protein
          Length = 564

 Score = 28.3 bits (60), Expect = 4.9
 Identities = 16/51 (31%), Positives = 27/51 (52%)
 Frame = +3

Query: 12  EPRHRTELYSDLRSRDARVKKKTDSIDLRDPNGLRRRVSRFECETRLVKSH 164
           +PR R  LY D  +  + + K+T S+D+   NG +   S+ E   R+ + H
Sbjct: 149 KPRKRMRLYGDGGAVSSHLHKETSSVDV---NGFQVLPSQAESVKRIFERH 196


>At1g67970.1 68414.m07764 heat shock factor protein, putative (HSF5)
           / heat shock transcription factor, putative (HSTF5)
           identical to heat shock transcription factor 5 (HSF5)
           SP:Q9S7U5 from [Arabidopsis thaliana]; contains Pfam
           profile: PF00447 HSF-type DNA-binding domain
          Length = 374

 Score = 27.5 bits (58), Expect = 8.6
 Identities = 12/44 (27%), Positives = 22/44 (50%)
 Frame = -1

Query: 289 GRWCEATIRGIILNASKAETSLAESGKDMLTVEPRESGGSKQCD 158
           G W +  +       +K + ++ + GKD LT+E  E  G+ + D
Sbjct: 286 GAWEKLLLLSPSRKKTKKQENIVKKGKDDLTLEEEEEDGTMELD 329


>At1g06460.1 68414.m00684 31.2 kDa small heat shock family protein /
           hsp20 family protein contains Pfam profile: PF00011
           Hsp20/alpha crystallin family
          Length = 285

 Score = 27.5 bits (58), Expect = 8.6
 Identities = 15/48 (31%), Positives = 24/48 (50%), Gaps = 1/48 (2%)
 Frame = -2

Query: 240 RPKPA*PNPARICSLWSPESREALNNVTLLVAFRIQNAR-RDVEAHLD 100
           RPK   P  A + ++WSP S  A +  + +VA  +  A   D+   +D
Sbjct: 169 RPKLDLPKLANLGTVWSPRSNVAESTHSYVVAIELPGASINDIRVEVD 216


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 14,810,756
Number of Sequences: 28952
Number of extensions: 299468
Number of successful extensions: 740
Number of sequences better than 10.0: 4
Number of HSP's better than 10.0 without gapping: 725
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 740
length of database: 12,070,560
effective HSP length: 79
effective length of database: 9,783,352
effective search space used: 1428369392
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).