SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fbVf0110
         (490 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At4g08480.1 68417.m01399 mitogen-activated protein kinase, putat...    30   0.73 
At4g08360.1 68417.m01381 KOW domain-containing protein contains ...    28   3.9  
At1g74690.1 68414.m08650 calmodulin-binding family protein low s...    27   5.1  
At4g33370.1 68417.m04744 DEAD-box protein abstrakt, putative RNA...    27   6.8  
At1g21730.1 68414.m02720 kinesin-related protein (MKRP1) Similar...    27   6.8  

>At4g08480.1 68417.m01399 mitogen-activated protein kinase, putative
           similar to mitogen-activated protein kinase [Arabidopsis
           thaliana] gi|1255448|dbj|BAA09057; contains Pfam
           PF00069: Protein kinase domain
          Length = 773

 Score = 30.3 bits (65), Expect = 0.73
 Identities = 17/69 (24%), Positives = 29/69 (42%)
 Frame = -1

Query: 364 KFYIDASYPEGNFGRTQLLDGSISLSPLYPVPTIDLQSESLRSSIRVSPDCDLTRHSSPS 185
           K  +D+   E   G   +    +   P+  +P +DL   S       +PD ++ R  S S
Sbjct: 375 KEVVDSGTVENRRGIKGVRPSVLKPPPVMKLPPVDLPGSSWDILTHFAPDSEIVRRPSSS 434

Query: 184 FGSQHLCSE 158
             S++ C E
Sbjct: 435 SSSENGCDE 443


>At4g08360.1 68417.m01381 KOW domain-containing protein contains
           Pfam PF00467: KOW motif
          Length = 141

 Score = 27.9 bits (59), Expect = 3.9
 Identities = 14/36 (38%), Positives = 22/36 (61%), Gaps = 2/36 (5%)
 Frame = +3

Query: 228 LMEDRSDSDCKSIVGTGYRGERLIEPSSSW--VRPK 329
           ++ D SD  CK  +G+G  G+ ++ PSS    VRP+
Sbjct: 55  VIRDVSDGMCKVSLGSGGEGDTIMVPSSELEIVRPR 90


>At1g74690.1 68414.m08650 calmodulin-binding family protein low
           similarity to SF16 protein [Helianthus annuus]
           GI:560150; contains Pfam profile PF00612: IQ
           calmodulin-binding motif
          Length = 587

 Score = 27.5 bits (58), Expect = 5.1
 Identities = 13/24 (54%), Positives = 16/24 (66%)
 Frame = -1

Query: 481 PASSFE*AGVLTHLKFENRLRSFR 410
           PAS+FE + V T  +FE   RSFR
Sbjct: 290 PASNFESSSVQTSFEFEKPKRSFR 313


>At4g33370.1 68417.m04744 DEAD-box protein abstrakt, putative RNA
           helicase DBP2 - Saccharomyces cerevisiae, PID:g5272
          Length = 542

 Score = 27.1 bits (57), Expect = 6.8
 Identities = 15/41 (36%), Positives = 20/41 (48%)
 Frame = +3

Query: 204 VRSQSGETLMEDRSDSDCKSIVGTGYRGERLIEPSSSWVRP 326
           V  + G+ +ME  SD      VG   RG    EP S+W +P
Sbjct: 24  VVEEPGKGMMEHLSDKKKLMSVGELARGITYTEPLSTWWKP 64


>At1g21730.1 68414.m02720 kinesin-related protein (MKRP1) Similar to
           gb|U06698 neuronal kinesin heavy chain from Homo sapiens
           and contains a PF|00225 Kinesin motor domain. EST
           gb|AA042507 comes from this gene; identical to cDNA
           MKRP1 mRNA for kinesin-related protein,  GI:16902291,
           kinesin-related protein [Arabidopsis thaliana]
           GI:16902292
          Length = 890

 Score = 27.1 bits (57), Expect = 6.8
 Identities = 11/22 (50%), Positives = 18/22 (81%)
 Frame = +3

Query: 372 VSSGKAHD*RHLGRNDLNLFSN 437
           ++SG+ H  RH+G N++NLFS+
Sbjct: 248 IASGEEH--RHVGSNNVNLFSS 267


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 10,226,017
Number of Sequences: 28952
Number of extensions: 210783
Number of successful extensions: 436
Number of sequences better than 10.0: 5
Number of HSP's better than 10.0 without gapping: 430
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 436
length of database: 12,070,560
effective HSP length: 76
effective length of database: 9,870,208
effective search space used: 848837888
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).