SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fbVf0109
         (498 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At1g53590.1 68414.m06088 C2 domain-containing protein                  57   6e-09
At5g04220.2 68418.m00411 C2 domain-containing protein (sytC) GC ...    56   1e-08
At5g04220.1 68418.m00410 C2 domain-containing protein (sytC) GC ...    56   1e-08
At3g14590.1 68416.m01847 C2 domain-containing protein low simila...    56   2e-08
At5g11100.1 68418.m01296 C2 domain-containing protein similar to...    52   2e-07
At3g61050.1 68416.m06832 calcium-dependent lipid-binding protein...    51   5e-07
At1g05500.1 68414.m00561 C2 domain-containing protein similar to...    51   5e-07
At4g11610.1 68417.m01859 C2 domain-containing protein contains I...    49   2e-06
At1g20080.1 68414.m02513 C2 domain-containing protein contains I...    47   8e-06
At1g03370.1 68414.m00316 C2 domain-containing protein / GRAM dom...    47   8e-06
At1g74720.1 68414.m08658 C2 domain-containing protein contains I...    45   3e-05
At2g20990.1 68415.m02485 C2 domain-containing protein (sytA) sim...    44   8e-05
At1g22610.1 68414.m02823 C2 domain-containing protein contains I...    43   1e-04
At5g17980.1 68418.m02109 C2 domain-containing protein contains I...    42   2e-04
At3g59660.1 68416.m06656 C2 domain-containing protein / GRAM dom...    42   2e-04
At1g04150.1 68414.m00405 C2 domain-containing protein contains I...    42   2e-04
At1g51570.1 68414.m05804 C2 domain-containing protein contains I...    41   5e-04
At1g07310.1 68414.m00778 C2 domain-containing protein contains s...    40   7e-04
At5g48060.1 68418.m05938 C2 domain-containing protein contains I...    38   0.003
At3g18370.1 68416.m02336 C2 domain-containing protein contains P...    38   0.003
At4g21160.4 68417.m03061 zinc finger and C2 domain protein (ZAC)...    38   0.004
At4g21160.3 68417.m03060 zinc finger and C2 domain protein (ZAC)...    38   0.004
At4g21160.2 68417.m03059 zinc finger and C2 domain protein (ZAC)...    38   0.004
At4g21160.1 68417.m03058 zinc finger and C2 domain protein (ZAC)...    38   0.004
At4g05330.1 68417.m00815 zinc finger and C2 domain protein, puta...    38   0.004
At5g47710.1 68418.m05891 C2 domain-containing protein contains s...    38   0.005
At3g57880.1 68416.m06452 C2 domain-containing protein contains I...    38   0.005
At5g12970.1 68418.m01487 C2 domain-containing protein contains I...    37   0.009
At4g00700.1 68417.m00096 C2 domain-containing protein contains I...    35   0.035
At1g70790.2 68414.m08163 C2 domain-containing protein similar to...    35   0.035
At1g70790.1 68414.m08162 C2 domain-containing protein similar to...    35   0.035
At4g11850.1 68417.m01886 phospholipase D gamma 1 / PLD gamma 1 (...    34   0.046
At4g11830.2 68417.m01884 phospholipase D gamma 2 / PLD gamma 2 (...    34   0.046
At4g11830.1 68417.m01883 phospholipase D gamma 2 / PLD gamma 2 (...    34   0.046
At4g11840.1 68417.m01885 phospholipase D gamma 3 / PLD gamma 3 (...    33   0.081
At3g07940.1 68416.m00971 zinc finger and C2 domain protein, puta...    33   0.11 
At4g00240.1 68417.m00031 phospholipase D beta 2 / PLD beta 2 (PL...    33   0.14 
At3g61300.1 68416.m06860 C2 domain-containing protein anthranila...    33   0.14 
At3g03680.1 68416.m00371 C2 domain-containing protein contains I...    33   0.14 
At4g20080.1 68417.m02937 C2 domain-containing protein contains I...    32   0.25 
At2g21010.1 68415.m02489 C2 domain-containing protein contains I...    32   0.25 
At3g61720.1 68416.m06919 C2 domain-containing protein contains I...    31   0.33 
At2g42010.1 68415.m05197 phospholipase D beta 1 / PLD beta 1 (PL...    31   0.33 
At1g70810.1 68414.m08168 C2 domain-containing protein similar to...    31   0.57 
At1g08150.1 68414.m00898 sodium/hydrogen exchanger family protei...    30   1.00 
At5g61900.3 68418.m07767 copine BONZAI1 (BON1) nearly identical ...    28   3.0  
At5g61900.1 68418.m07766 copine BONZAI1 (BON1) nearly identical ...    28   3.0  
At3g47220.1 68416.m05127 phosphoinositide-specific phospholipase...    28   4.0  
At2g40950.1 68415.m05056 bZIP transcription factor family protei...    28   4.0  
At1g08860.1 68414.m00987 copine, putative Similar to BONZAI1 [Ar...    28   4.0  
At5g58670.1 68418.m07351 phosphoinositide-specific phospholipase...    27   5.3  
At2g20770.1 68415.m02441 lanthionine synthetase C-like family pr...    27   5.3  
At5g14160.1 68418.m01656 F-box family protein contains F-box dom...    27   9.3  
At5g13480.1 68418.m01554 WD-40 repeat family protein similar to ...    27   9.3  
At3g61030.1 68416.m06828 C2 domain-containing protein similar to...    27   9.3  
At3g60950.1 68416.m06819 C2 domain-containing protein similar to...    27   9.3  

>At1g53590.1 68414.m06088 C2 domain-containing protein
          Length = 751

 Score = 57.2 bits (132), Expect = 6e-09
 Identities = 30/72 (41%), Positives = 43/72 (59%)
 Frame = +1

Query: 268 VEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPMSGTVN 447
           VEV EA+DL P D NGL+DP+V   L    ++R+ T ++  TL+P W E F +P+    +
Sbjct: 286 VEVFEASDLKPSDLNGLADPYVKGKL---GAYRFKTKIQKKTLSPKWHEEFKIPIFTWDS 342

Query: 448 EDSLCLEVWDFD 483
              L +EV D D
Sbjct: 343 PSILNIEVGDKD 354


>At5g04220.2 68418.m00411 C2 domain-containing protein (sytC) GC
           donor splice site at exon 3; similar to Ca2+-dependent
           lipid-binding protein (CLB1) GI:2789434 from
           [Lycopersicon esculentum]
          Length = 540

 Score = 56.4 bits (130), Expect = 1e-08
 Identities = 29/75 (38%), Positives = 42/75 (56%)
 Frame = +1

Query: 259 MLNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPMSG 438
           +L+V ++ A +L+ KD  G SDP+V + L         T++K   LNP W EHF L +  
Sbjct: 262 LLHVSILRARNLLKKDLLGTSDPYVKLSLTGEKLPAKKTTIKKRNLNPEWNEHFKLIVKD 321

Query: 439 TVNEDSLCLEVWDFD 483
             N   L LEV+D+D
Sbjct: 322 P-NSQVLQLEVFDWD 335


>At5g04220.1 68418.m00410 C2 domain-containing protein (sytC) GC
           donor splice site at exon 3; similar to Ca2+-dependent
           lipid-binding protein (CLB1) GI:2789434 from
           [Lycopersicon esculentum]
          Length = 318

 Score = 56.4 bits (130), Expect = 1e-08
 Identities = 29/75 (38%), Positives = 42/75 (56%)
 Frame = +1

Query: 259 MLNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPMSG 438
           +L+V ++ A +L+ KD  G SDP+V + L         T++K   LNP W EHF L +  
Sbjct: 40  LLHVSILRARNLLKKDLLGTSDPYVKLSLTGEKLPAKKTTIKKRNLNPEWNEHFKLIVKD 99

Query: 439 TVNEDSLCLEVWDFD 483
             N   L LEV+D+D
Sbjct: 100 P-NSQVLQLEVFDWD 113


>At3g14590.1 68416.m01847 C2 domain-containing protein low
           similarity to SP|Q16974 Calcium-dependent protein kinase
           C (EC 2.7.1.-) {Aplysia californica}; contains Pfam
           profile PF00168: C2 domain
          Length = 737

 Score = 55.6 bits (128), Expect = 2e-08
 Identities = 30/72 (41%), Positives = 43/72 (59%)
 Frame = +1

Query: 268 VEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPMSGTVN 447
           VEVVEA D+ P D NGL+DP+V   L    ++R+ T +   TL P W+E F +P+    +
Sbjct: 287 VEVVEACDVKPSDLNGLADPYVKGQL---GAYRFKTKILWKTLAPKWQEEFKIPICTWDS 343

Query: 448 EDSLCLEVWDFD 483
            + L +EV D D
Sbjct: 344 ANILNIEVQDKD 355


>At5g11100.1 68418.m01296 C2 domain-containing protein similar to
           Ca2+-dependent lipid-binding protein (CLB1) GI:2789434
           from [Lycopersicon esculentum]
          Length = 574

 Score = 52.4 bits (120), Expect = 2e-07
 Identities = 26/72 (36%), Positives = 39/72 (54%)
 Frame = +1

Query: 262 LNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPMSGT 441
           L+V+VV+A DL  KD  G SDP+  +++         T   S +LNP+W EHF   +   
Sbjct: 273 LDVKVVQAKDLANKDMIGKSDPYAIVFIRPLPDRTKKTKTISNSLNPIWNEHFEFIVE-D 331

Query: 442 VNEDSLCLEVWD 477
           V+   L + V+D
Sbjct: 332 VSTQHLTVRVFD 343



 Score = 50.4 bits (115), Expect = 7e-07
 Identities = 31/75 (41%), Positives = 40/75 (53%)
 Frame = +1

Query: 259 MLNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPMSG 438
           +L+V VV A DL   D  G +D FV I L   S  +  T V   +LNPVW + F   +  
Sbjct: 449 VLSVTVVAAEDLPAVDFMGKADAFVVITL-KKSETKSKTRVVPDSLNPVWNQTFDFVVED 507

Query: 439 TVNEDSLCLEVWDFD 483
            ++ D L LEVWD D
Sbjct: 508 ALH-DLLTLEVWDHD 521


>At3g61050.1 68416.m06832 calcium-dependent lipid-binding protein,
           putative strong similarity to CLB1 [Lycopersicon
           esculentum] GI:2789434; contains Pfam profile PF00168:
           C2 domain
          Length = 510

 Score = 50.8 bits (116), Expect = 5e-07
 Identities = 30/74 (40%), Positives = 42/74 (56%)
 Frame = +1

Query: 262 LNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPMSGT 441
           L V VV+AT+L  K+  G SDP+ TIY+      +Y T      LNPVW++ F L ++  
Sbjct: 265 LIVTVVKATNLKNKELIGKSDPYATIYI--RPVFKYKTKAIENNLNPVWDQTFEL-IAED 321

Query: 442 VNEDSLCLEVWDFD 483
               SL +EV+D D
Sbjct: 322 KETQSLTVEVFDKD 335


>At1g05500.1 68414.m00561 C2 domain-containing protein similar to
           Ca2+-dependent lipid-binding protein (CLB1) GI:2789434
           from [Lycopersicon esculentum]
          Length = 528

 Score = 50.8 bits (116), Expect = 5e-07
 Identities = 27/75 (36%), Positives = 43/75 (57%)
 Frame = +1

Query: 259 MLNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPMSG 438
           +L+V V+ A ++  +D  G +DP+V +  M  S  +  T V + +LNPVW + F   +  
Sbjct: 404 VLSVTVISAEEIPIQDLMGKADPYVVLS-MKKSGAKSKTRVVNDSLNPVWNQTFDFVVED 462

Query: 439 TVNEDSLCLEVWDFD 483
            ++ D L LEVWD D
Sbjct: 463 GLH-DMLVLEVWDHD 476



 Score = 45.6 bits (103), Expect = 2e-05
 Identities = 22/73 (30%), Positives = 37/73 (50%)
 Frame = +1

Query: 259 MLNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPMSG 438
           ML V++V+A +L  KD  G SDPF  +++         +   +  LNP+W EHF   +  
Sbjct: 231 MLEVKLVQAKNLTNKDLVGKSDPFAKMFIRPLREKTKRSKTINNDLNPIWNEHFEFVVE- 289

Query: 439 TVNEDSLCLEVWD 477
             +   L + ++D
Sbjct: 290 DASTQHLVVRIYD 302


>At4g11610.1 68417.m01859 C2 domain-containing protein contains
           INTERPRO:IPR000008 C2 domain
          Length = 1011

 Score = 48.8 bits (111), Expect = 2e-06
 Identities = 24/62 (38%), Positives = 35/62 (56%)
 Frame = +1

Query: 250 SGLMLNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLP 429
           S L L V+V+ A +L PKD  G S+ +V +Y       ++ T++K   LNPVW E F   
Sbjct: 4   SNLKLGVDVIGAHNLFPKDGQGTSNAYVELYF---DGQKHRTTIKDRDLNPVWNESFFFN 60

Query: 430 MS 435
           +S
Sbjct: 61  IS 62



 Score = 32.7 bits (71), Expect = 0.14
 Identities = 23/72 (31%), Positives = 32/72 (44%)
 Frame = +1

Query: 262 LNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPMSGT 441
           + V V+EA DL+P D     D +V   L   +        ++ TL  VW E F   ++  
Sbjct: 444 VRVNVIEAQDLIPTDKTRFPDVYVKAQL--GNQVMKTRPCQARTLGAVWNEDFLFVVAEP 501

Query: 442 VNEDSLCLEVWD 477
             ED L L V D
Sbjct: 502 F-EDHLVLTVED 512


>At1g20080.1 68414.m02513 C2 domain-containing protein contains
           INTERPRO:IPR000008 C2 domain
          Length = 535

 Score = 46.8 bits (106), Expect = 8e-06
 Identities = 27/75 (36%), Positives = 42/75 (56%)
 Frame = +1

Query: 259 MLNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPMSG 438
           +L+V+V++A  L  KD  G SDP+V + L  +      T VK   LNP W E F L +  
Sbjct: 259 LLSVKVIKAIKLKKKDLLGGSDPYVKLTLSGDKVPGKKTVVKHSNLNPEWNEEFDLVVKE 318

Query: 439 TVNEDSLCLEVWDFD 483
             +++ L L V+D++
Sbjct: 319 PESQE-LQLIVYDWE 332


>At1g03370.1 68414.m00316 C2 domain-containing protein / GRAM
            domain-containing protein contains Pfam profiles PF00168:
            C2 domain; contains PF02893: GRAM domain; similar to
            Chain A, Crystal Structure Of Synaptotagmin Iii C2aC2B
            Length(GI:6980525); similar to Synaptotagmin III (SytIII)
            (Swiss-Prot:P40748) [Rattus norvegicus]
          Length = 1859

 Score = 46.8 bits (106), Expect = 8e-06
 Identities = 30/76 (39%), Positives = 36/76 (47%)
 Frame = +1

Query: 256  LMLNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPMS 435
            + L V VVEA +L   D NG SDP+V + L      R  T V    LNP W E FS  + 
Sbjct: 827  MKLQVRVVEARNLPAMDLNGFSDPYVRLQL---GKQRSRTKVVKKNLNPKWTEDFSFGVD 883

Query: 436  GTVNEDSLCLEVWDFD 483
                 D L + V D D
Sbjct: 884  DL--NDELVVSVLDED 897



 Score = 43.6 bits (98), Expect = 8e-05
 Identities = 28/77 (36%), Positives = 37/77 (48%)
 Frame = +1

Query: 253  GLMLNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPM 432
            G +L V ++E  DL   DP+G  DP+  I   SN   R  +S+K    NP W E F    
Sbjct: 1360 GWLLTVALIEGVDLAAVDPSGHCDPY--IVFTSNGKTR-TSSIKFQKSNPQWNEIFEFDA 1416

Query: 433  SGTVNEDSLCLEVWDFD 483
                    L +EV+DFD
Sbjct: 1417 MAD-PPSVLNVEVFDFD 1432


>At1g74720.1 68414.m08658 C2 domain-containing protein contains
           INTERPRO:IPR000008 C2 domain
          Length = 1081

 Score = 44.8 bits (101), Expect = 3e-05
 Identities = 27/74 (36%), Positives = 39/74 (52%), Gaps = 2/74 (2%)
 Frame = +1

Query: 262 LNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPMSGT 441
           L VEVVEA +++PKD  G S  +V +      + +  TS K   LNP+W E     +S  
Sbjct: 19  LVVEVVEARNILPKDGQGSSSAYVVV---DFDAQKKRTSTKFRDLNPIWNEMLDFAVSDP 75

Query: 442 VN--EDSLCLEVWD 477
            N   D L +EV++
Sbjct: 76  KNMDYDELDIEVYN 89


>At2g20990.1 68415.m02485 C2 domain-containing protein (sytA)
           similar to Ca2+-dependent lipid-binding protein (CLB1)
           GI:2789434 from [Lycopersicon esculentum]
          Length = 541

 Score = 43.6 bits (98), Expect = 8e-05
 Identities = 23/54 (42%), Positives = 30/54 (55%)
 Frame = +1

Query: 259 MLNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHF 420
           +++V+VV A  L  KD  G +DPFV I L  +      T+VK   LNP W E F
Sbjct: 261 IVHVKVVRAVGLRKKDLMGGADPFVKIKLSEDKIPSKKTTVKHKNLNPEWNEEF 314


>At1g22610.1 68414.m02823 C2 domain-containing protein contains
           INTERPRO:IPR000008 C2 domain
          Length = 1029

 Score = 42.7 bits (96), Expect = 1e-04
 Identities = 25/74 (33%), Positives = 39/74 (52%), Gaps = 2/74 (2%)
 Frame = +1

Query: 262 LNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEH--FSLPMS 435
           L VE+V+A+DL+PKD  G + PFV +        R  T  +   LNP W E   F++   
Sbjct: 4   LVVEIVDASDLMPKDGQGSASPFVEVEF---DEQRQRTQTRFKDLNPQWNEKLVFNVGDL 60

Query: 436 GTVNEDSLCLEVWD 477
             +N  ++ + V+D
Sbjct: 61  KRLNNKTVDVTVYD 74



 Score = 36.3 bits (80), Expect = 0.011
 Identities = 23/72 (31%), Positives = 34/72 (47%)
 Frame = +1

Query: 262 LNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPMSGT 441
           L + V+EA DLVP D   + D  V I   + +  R   + +  T+NP W E     +S  
Sbjct: 459 LRIHVMEAQDLVPSDKGRVPDAIVKI--QAGNQMRATRTPQMRTMNPQWHEELMFVVSEP 516

Query: 442 VNEDSLCLEVWD 477
             ED + + V D
Sbjct: 517 F-EDMVIVSVDD 527


>At5g17980.1 68418.m02109 C2 domain-containing protein contains
           INTERPRO:IPR000008 C2 domain
          Length = 1049

 Score = 42.3 bits (95), Expect = 2e-04
 Identities = 27/57 (47%), Positives = 32/57 (56%), Gaps = 2/57 (3%)
 Frame = +1

Query: 262 LNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEE--HFSL 426
           L VEVV+A DL PKD +G S P+V +        R  T V+   LNPVW E   FSL
Sbjct: 7   LVVEVVDAKDLTPKDGHGTSSPYVVLDYY-GQRRRTRTIVRD--LNPVWNETLEFSL 60


>At3g59660.1 68416.m06656 C2 domain-containing protein / GRAM
           domain-containing protein low similarity to GLUT4
           vesicle protein [Rattus norvegicus] GI:4193489; contains
           Pfam profiles PF00168: C2 domain, PF02893: GRAM domain
          Length = 594

 Score = 41.9 bits (94), Expect = 2e-04
 Identities = 23/80 (28%), Positives = 42/80 (52%)
 Frame = +1

Query: 259 MLNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPMSG 438
           ++ VE++ A +L+  + NG SDP+  +     S  R+++ V  G+ NP+W E F+ P   
Sbjct: 82  IVKVELLAAKNLIGANLNGTSDPYAIVNC--GSEKRFSSMVP-GSRNPMWGEEFNFPTDE 138

Query: 439 TVNEDSLCLEVWDFDPAETV 498
              + ++ +  WD     TV
Sbjct: 139 LPAKINVTIHDWDIIWKSTV 158


>At1g04150.1 68414.m00405 C2 domain-containing protein contains
           INTERPRO:IPR000008 C2 domain
          Length = 1012

 Score = 41.9 bits (94), Expect = 2e-04
 Identities = 22/51 (43%), Positives = 28/51 (54%)
 Frame = +1

Query: 262 LNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEE 414
           L VE+V A +L+PKD    S PFV +      + R  T VK   LNP+W E
Sbjct: 13  LVVEIVGAHNLMPKDGEDSSSPFVEVQF---ENQRLRTKVKPKDLNPIWNE 60


>At1g51570.1 68414.m05804 C2 domain-containing protein contains
           INTERPRO:IPR000008 C2 domain
          Length = 776

 Score = 40.7 bits (91), Expect = 5e-04
 Identities = 25/72 (34%), Positives = 38/72 (52%)
 Frame = +1

Query: 262 LNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPMSGT 441
           L V V+EA DL+P D     + FV + +M N + R   S +S ++NP+W E     ++  
Sbjct: 203 LRVNVIEAQDLIPSDKGRYPEVFVKV-IMGNQALRTRVS-QSRSINPMWNEDLMFVVAEP 260

Query: 442 VNEDSLCLEVWD 477
             E+ L L V D
Sbjct: 261 F-EEPLILSVED 271


>At1g07310.1 68414.m00778 C2 domain-containing protein contains
           similarity to shock protein SRC2 [Glycine max]
           gi|2055230|dbj|BAA19769 ; contains Pfam profile
           PF00168:C2 domain
          Length = 352

 Score = 40.3 bits (90), Expect = 7e-04
 Identities = 28/75 (37%), Positives = 42/75 (56%), Gaps = 2/75 (2%)
 Frame = +1

Query: 256 LMLNVEVVEATDLVPKD-PNGLSDPFVTIYLMSNSSHRYNT-SVKSGTLNPVWEEHFSLP 429
           L L V VV A  L   +  NG   P+V +YL  +  H  +T S  S ++ PVW E  +LP
Sbjct: 7   LDLVVTVVSAKHLKNVNWRNGDLKPYVVLYL--DQDHPLSTRSDDSSSIKPVWNERITLP 64

Query: 430 MSGTVNEDSLCLEVW 474
           ++ +V+E  L +EV+
Sbjct: 65  LTRSVHESVLNIEVF 79


>At5g48060.1 68418.m05938 C2 domain-containing protein contains
           INTERPRO:IPR000008 C2 domain
          Length = 1036

 Score = 38.3 bits (85), Expect = 0.003
 Identities = 24/72 (33%), Positives = 36/72 (50%)
 Frame = +1

Query: 262 LNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPMSGT 441
           L V V+EA D++P D N L D FV   +   +      S+K  T NP+W+E     ++  
Sbjct: 461 LRVNVIEAQDMIPSDRNRLPDVFVKASVGMQTLKTSICSIK--TTNPLWKEDLVFVVAEP 518

Query: 442 VNEDSLCLEVWD 477
             E+ L + V D
Sbjct: 519 F-EEQLVISVED 529



 Score = 37.1 bits (82), Expect = 0.007
 Identities = 26/72 (36%), Positives = 39/72 (54%), Gaps = 2/72 (2%)
 Frame = +1

Query: 262 LNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEE--HFSLPMS 435
           L V VV+A  L+P+D  G + PFV +  + N   +  T  KS  LNPVW +  +F    S
Sbjct: 7   LVVHVVDAQYLMPRDGQGSASPFVEVDFL-NQLSKTRTVPKS--LNPVWNQKLYFDYDQS 63

Query: 436 GTVNEDSLCLEV 471
             +N+ +  +EV
Sbjct: 64  -VINQHNQHIEV 74


>At3g18370.1 68416.m02336 C2 domain-containing protein contains Pfam
           profile: PF00168 C2 domain
          Length = 815

 Score = 38.3 bits (85), Expect = 0.003
 Identities = 25/75 (33%), Positives = 36/75 (48%)
 Frame = +1

Query: 259 MLNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPMSG 438
           ++ + +VEA DLV  D  G SDP+V +        +  T V   TL P W +    P  G
Sbjct: 606 LIELVLVEARDLVAADIRGTSDPYVRV---QYGEKKQRTKVIYKTLQPKWNQTMEFPDDG 662

Query: 439 TVNEDSLCLEVWDFD 483
           +    SL L V D++
Sbjct: 663 S----SLELHVKDYN 673


>At4g21160.4 68417.m03061 zinc finger and C2 domain protein (ZAC)
           identical to zinc finger and C2 domain protein
           GI:9957238 from [Arabidopsis thaliana]
          Length = 337

 Score = 37.9 bits (84), Expect = 0.004
 Identities = 27/75 (36%), Positives = 42/75 (56%)
 Frame = +1

Query: 259 MLNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPMSG 438
           +L V + + T++  +D    SDP+V + L    +   +T VKS  LNPVW E   L +S 
Sbjct: 182 LLKVTIKKGTNMAIRDMMS-SDPYVVLTLGQQKAQ--STVVKSN-LNPVWNE--ELMLSV 235

Query: 439 TVNEDSLCLEVWDFD 483
             N  S+ L+V+D+D
Sbjct: 236 PHNYGSVKLQVFDYD 250


>At4g21160.3 68417.m03060 zinc finger and C2 domain protein (ZAC)
           identical to zinc finger and C2 domain protein
           GI:9957238 from [Arabidopsis thaliana]
          Length = 337

 Score = 37.9 bits (84), Expect = 0.004
 Identities = 27/75 (36%), Positives = 42/75 (56%)
 Frame = +1

Query: 259 MLNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPMSG 438
           +L V + + T++  +D    SDP+V + L    +   +T VKS  LNPVW E   L +S 
Sbjct: 182 LLKVTIKKGTNMAIRDMMS-SDPYVVLTLGQQKAQ--STVVKSN-LNPVWNE--ELMLSV 235

Query: 439 TVNEDSLCLEVWDFD 483
             N  S+ L+V+D+D
Sbjct: 236 PHNYGSVKLQVFDYD 250


>At4g21160.2 68417.m03059 zinc finger and C2 domain protein (ZAC)
           identical to zinc finger and C2 domain protein
           GI:9957238 from [Arabidopsis thaliana]
          Length = 337

 Score = 37.9 bits (84), Expect = 0.004
 Identities = 27/75 (36%), Positives = 42/75 (56%)
 Frame = +1

Query: 259 MLNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPMSG 438
           +L V + + T++  +D    SDP+V + L    +   +T VKS  LNPVW E   L +S 
Sbjct: 182 LLKVTIKKGTNMAIRDMMS-SDPYVVLTLGQQKAQ--STVVKSN-LNPVWNE--ELMLSV 235

Query: 439 TVNEDSLCLEVWDFD 483
             N  S+ L+V+D+D
Sbjct: 236 PHNYGSVKLQVFDYD 250


>At4g21160.1 68417.m03058 zinc finger and C2 domain protein (ZAC)
           identical to zinc finger and C2 domain protein
           GI:9957238 from [Arabidopsis thaliana]
          Length = 337

 Score = 37.9 bits (84), Expect = 0.004
 Identities = 27/75 (36%), Positives = 42/75 (56%)
 Frame = +1

Query: 259 MLNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPMSG 438
           +L V + + T++  +D    SDP+V + L    +   +T VKS  LNPVW E   L +S 
Sbjct: 182 LLKVTIKKGTNMAIRDMMS-SDPYVVLTLGQQKAQ--STVVKSN-LNPVWNE--ELMLSV 235

Query: 439 TVNEDSLCLEVWDFD 483
             N  S+ L+V+D+D
Sbjct: 236 PHNYGSVKLQVFDYD 250


>At4g05330.1 68417.m00815 zinc finger and C2 domain protein,
           putative similar to zinc finger and C2 domain protein
           GI:9957238 from [Arabidopsis thaliana]
          Length = 336

 Score = 37.9 bits (84), Expect = 0.004
 Identities = 28/88 (31%), Positives = 45/88 (51%)
 Frame = +1

Query: 220 TSYQSGG*RASGLMLNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLN 399
           T +Q G     GL L V + + T+L  +D    SDP+V + L      +  T+V +  LN
Sbjct: 169 TMFQEGMVEFIGL-LKVTIKKGTNLAIRDMMS-SDPYVVLNL---GKQKLQTTVMNSNLN 223

Query: 400 PVWEEHFSLPMSGTVNEDSLCLEVWDFD 483
           PVW +   L +S   +   + L+V+D+D
Sbjct: 224 PVWNQ--ELMLSVPESYGPVKLQVYDYD 249


>At5g47710.1 68418.m05891 C2 domain-containing protein contains
           similarity to CLB1 [Lycopersicon esculentum] GI:2789434;
           contains Pfam profile PF00168: C2 domain
          Length = 166

 Score = 37.5 bits (83), Expect = 0.005
 Identities = 26/75 (34%), Positives = 38/75 (50%)
 Frame = +1

Query: 259 MLNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPMSG 438
           +L V V++   LV +D    SDP+V + L + S+    T V +  LNPVW E  +  +  
Sbjct: 7   LLQVTVIQGKKLVIRDFKS-SDPYVIVKLGNESA---KTKVINNCLNPVWNEELNFTLKD 62

Query: 439 TVNEDSLCLEVWDFD 483
                 L LEV+D D
Sbjct: 63  PA--AVLALEVFDKD 75


>At3g57880.1 68416.m06452 C2 domain-containing protein contains
           INTERPRO:IPR000008 C2 domain
          Length = 773

 Score = 37.5 bits (83), Expect = 0.005
 Identities = 24/72 (33%), Positives = 37/72 (51%)
 Frame = +1

Query: 262 LNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPMSGT 441
           L V V+EA DL+P D     + +V   ++ N + R   S +S T+NP+W E     ++  
Sbjct: 203 LRVNVIEAQDLIPTDKQRYPEVYVKA-IVGNQALRTRVS-QSRTINPMWNEDLMF-VAAE 259

Query: 442 VNEDSLCLEVWD 477
             E+ L L V D
Sbjct: 260 PFEEPLILSVED 271


>At5g12970.1 68418.m01487 C2 domain-containing protein contains
           INTERPRO:IPR000008 C2 domain
          Length = 769

 Score = 36.7 bits (81), Expect = 0.009
 Identities = 23/72 (31%), Positives = 38/72 (52%)
 Frame = +1

Query: 262 LNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPMSGT 441
           + V V+EA DL+P D     + +V   ++ N + R   S ++ TLNP+W E     ++  
Sbjct: 203 VRVNVIEAQDLIPHDKTKFPEVYVKA-MLGNQTLRTRIS-QTKTLNPMWNEDLMFVVAEP 260

Query: 442 VNEDSLCLEVWD 477
             E++L L V D
Sbjct: 261 F-EEALILAVED 271


>At4g00700.1 68417.m00096 C2 domain-containing protein contains
           INTERPRO:IPR000008 C2 domain
          Length = 1006

 Score = 34.7 bits (76), Expect = 0.035
 Identities = 19/62 (30%), Positives = 29/62 (46%)
 Frame = +1

Query: 250 SGLMLNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLP 429
           S + L VEV+ A  L+ +D +    PFV +      +  +  + K    NPVW E F   
Sbjct: 2   SNIKLGVEVISAQGLLQRDKHNSCSPFVELKF---DNQIFRATTKHNDPNPVWHECFYFV 58

Query: 430 MS 435
           +S
Sbjct: 59  VS 60


>At1g70790.2 68414.m08163 C2 domain-containing protein similar to
           zinc finger and C2 domain protein GI:9957238 from
           [Arabidopsis thaliana]
          Length = 185

 Score = 34.7 bits (76), Expect = 0.035
 Identities = 26/75 (34%), Positives = 38/75 (50%)
 Frame = +1

Query: 259 MLNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPMSG 438
           +L V V    +L  +D    SDP+V I L   ++ +  T V +   NPVW E  +L +  
Sbjct: 8   ILRVHVKRGINLAIRDAT-TSDPYVVITL---ANQKLKTRVINNNCNPVWNEQLTLSIK- 62

Query: 439 TVNEDSLCLEVWDFD 483
            VN D + L V+D D
Sbjct: 63  DVN-DPIRLTVFDKD 76


>At1g70790.1 68414.m08162 C2 domain-containing protein similar to
           zinc finger and C2 domain protein GI:9957238 from
           [Arabidopsis thaliana]
          Length = 185

 Score = 34.7 bits (76), Expect = 0.035
 Identities = 26/75 (34%), Positives = 38/75 (50%)
 Frame = +1

Query: 259 MLNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPMSG 438
           +L V V    +L  +D    SDP+V I L   ++ +  T V +   NPVW E  +L +  
Sbjct: 8   ILRVHVKRGINLAIRDAT-TSDPYVVITL---ANQKLKTRVINNNCNPVWNEQLTLSIK- 62

Query: 439 TVNEDSLCLEVWDFD 483
            VN D + L V+D D
Sbjct: 63  DVN-DPIRLTVFDKD 76


>At4g11850.1 68417.m01886 phospholipase D gamma 1 / PLD gamma 1
           (PLDGAMMA1) identical to phospholipase D gamma 1
           SP:Q9T053 from [Arabidopsis thaliana]
          Length = 858

 Score = 34.3 bits (75), Expect = 0.046
 Identities = 17/44 (38%), Positives = 26/44 (59%)
 Frame = +1

Query: 319 SDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPMSGTVNE 450
           SDP+VT+ +      R  T V S + NPVW +HF +P++ +  E
Sbjct: 86  SDPYVTVSISGAVIGR--TFVISNSENPVWMQHFDVPVAHSAAE 127


>At4g11830.2 68417.m01884 phospholipase D gamma 2 / PLD gamma 2
           (PLDGAMMA2) identical to SP|Q9T051 Phospholipase D gamma
           2 (EC 3.1.4.4) (AtPLDgamma2) (PLD gamma 2) [Arabidopsis
           thaliana]
          Length = 856

 Score = 34.3 bits (75), Expect = 0.046
 Identities = 17/44 (38%), Positives = 26/44 (59%)
 Frame = +1

Query: 319 SDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPMSGTVNE 450
           SDP+VT+ +      R  T V S + NPVW +HF +P++ +  E
Sbjct: 84  SDPYVTVSISGAVIGR--TFVISNSENPVWMQHFDVPVAHSAAE 125


>At4g11830.1 68417.m01883 phospholipase D gamma 2 / PLD gamma 2
           (PLDGAMMA2) identical to SP|Q9T051 Phospholipase D gamma
           2 (EC 3.1.4.4) (AtPLDgamma2) (PLD gamma 2) [Arabidopsis
           thaliana]
          Length = 824

 Score = 34.3 bits (75), Expect = 0.046
 Identities = 17/44 (38%), Positives = 26/44 (59%)
 Frame = +1

Query: 319 SDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPMSGTVNE 450
           SDP+VT+ +      R  T V S + NPVW +HF +P++ +  E
Sbjct: 52  SDPYVTVSISGAVIGR--TFVISNSENPVWMQHFDVPVAHSAAE 93


>At4g11840.1 68417.m01885 phospholipase D gamma 3 / PLD gamma 3
           (PLDGAMMA3) identical to phospholipase D gamma 3
           sp:Q9T052 from [Arabidopsis thaliana]
          Length = 866

 Score = 33.5 bits (73), Expect = 0.081
 Identities = 16/39 (41%), Positives = 24/39 (61%)
 Frame = +1

Query: 319 SDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPMS 435
           SDP+VT+ +      R  T V S + NPVW +HF +P++
Sbjct: 93  SDPYVTVSISGAVIGR--TFVISNSENPVWMQHFDVPVA 129


>At3g07940.1 68416.m00971 zinc finger and C2 domain protein,
           putative similar to zinc finger and C2 domain protein
           GI:9957238 from [Arabidopsis thaliana];contains Pfam
           profile: PF01412 Putative GTP-ase activating protein for
           Arf
          Length = 385

 Score = 33.1 bits (72), Expect = 0.11
 Identities = 21/56 (37%), Positives = 28/56 (50%)
 Frame = +1

Query: 259 MLNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSL 426
           ++ V VV+ T+L  +D    SDP+V + L   S     T V    LNPVW E   L
Sbjct: 230 LIKVNVVKGTNLAVRDVM-TSDPYVILALGQQS---VKTRVIKNNLNPVWNETLML 281


>At4g00240.1 68417.m00031 phospholipase D beta 2 / PLD beta 2
           (PLDBETA2) / PLDdelta1 identical to SP|O23078
           Phospholipase D beta 2 (EC 3.1.4.4) (AtPLDbeta2) (PLD
           beta 2) (PLDdelta1) [Arabidopsis thaliana]; contains
           Pfam profiles: PF00614 phospholipase D.active site
           motif, PF00168 C2 domain
          Length = 927

 Score = 32.7 bits (71), Expect = 0.14
 Identities = 16/39 (41%), Positives = 25/39 (64%)
 Frame = +1

Query: 319 SDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPMS 435
           SDP+V+I +      R  T V S + NPVW++HF +P++
Sbjct: 160 SDPYVSISVAGAVIGR--TYVISNSENPVWQQHFYVPVA 196


>At3g61300.1 68416.m06860 C2 domain-containing protein anthranilate
           phosphoribosyltransferase (fragment) - Pisum sativum,
           PIR:T06460
          Length = 972

 Score = 32.7 bits (71), Expect = 0.14
 Identities = 22/56 (39%), Positives = 31/56 (55%), Gaps = 1/56 (1%)
 Frame = +1

Query: 262 LNVEVVEATDLV-PKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSL 426
           L V V+EA DLV   D   L +P+V I L    +++   +  S +LNP W E F+L
Sbjct: 406 LRVNVIEAQDLVIVPDRTRLPNPYVKIRL----NNQVVRTKPSHSLNPRWNEEFTL 457



 Score = 29.9 bits (64), Expect = 1.00
 Identities = 21/83 (25%), Positives = 38/83 (45%)
 Frame = +1

Query: 250 SGLMLNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLP 429
           S L L VEV+ A  L P++  G  + +V +        +  T  K    +PVW E F   
Sbjct: 3   SNLKLGVEVISAR-LKPREDYGGVNAYVELRF---DDQKVITMTKIDDSSPVWNEKFFFN 58

Query: 430 MSGTVNEDSLCLEVWDFDPAETV 498
           +S T +  +  L+ + ++   ++
Sbjct: 59  ISDTEDLSNQFLDAYVYNKTSSI 81


>At3g03680.1 68416.m00371 C2 domain-containing protein contains
           INTERPRO:IPR000008 C2 domain
          Length = 1017

 Score = 32.7 bits (71), Expect = 0.14
 Identities = 17/51 (33%), Positives = 25/51 (49%)
 Frame = +1

Query: 262 LNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEE 414
           L VE+  A +L+PKD  G +  +    ++     R  T  K   LNP W+E
Sbjct: 9   LIVEICSARNLMPKDGQGTASAYA---IVDFDGQRRRTKTKFRDLNPQWDE 56


>At4g20080.1 68417.m02937 C2 domain-containing protein contains
           INTERPRO:IPR000008 C2 domain
          Length = 774

 Score = 31.9 bits (69), Expect = 0.25
 Identities = 23/72 (31%), Positives = 36/72 (50%)
 Frame = +1

Query: 262 LNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPMSGT 441
           L V V+EA DLV   PN ++   +    + N   R   S ++ +++PVW E     ++  
Sbjct: 205 LRVNVIEAQDLVLLHPNRINPEILIKGFLGNVVVRSRIS-QTKSVSPVWNEDMMF-VAVE 262

Query: 442 VNEDSLCLEVWD 477
             +DSL L V D
Sbjct: 263 PFDDSLILSVED 274


>At2g21010.1 68415.m02489 C2 domain-containing protein contains
           INTERPRO:IPR000008 C2 domain
          Length = 256

 Score = 31.9 bits (69), Expect = 0.25
 Identities = 14/36 (38%), Positives = 19/36 (52%)
 Frame = +1

Query: 313 GLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHF 420
           G+ +P+V I L  +      T+VK   LNP W E F
Sbjct: 2   GMINPYVQIELSEDKISSKKTTVKHKNLNPEWNEEF 37


>At3g61720.1 68416.m06919 C2 domain-containing protein contains
           INTERPRO:IPR000008 C2 domain
          Length = 795

 Score = 31.5 bits (68), Expect = 0.33
 Identities = 23/65 (35%), Positives = 29/65 (44%), Gaps = 4/65 (6%)
 Frame = +1

Query: 262 LNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHF----SLP 429
           + V +V   DL+ KD N     +VT  L         T V SGT NP W +      S P
Sbjct: 201 VRVTIVSGHDLISKDKNKTPSVYVTATL---GKVALKTKVSSGT-NPSWNQDLIFVASEP 256

Query: 430 MSGTV 444
           + GTV
Sbjct: 257 LEGTV 261


>At2g42010.1 68415.m05197 phospholipase D beta 1 / PLD beta 1
           (PLDBETA1) identical to SP|P93733 Phospholipase D beta 1
           (EC 3.1.4.4) (AtPLDbeta1) (PLD beta 1) (PLDbeta)
           {Arabidopsis thaliana}; contains Pfam profiles: PF00614
           phospholipase D.active site motif, PF00168 C2 domain
          Length = 1083

 Score = 31.5 bits (68), Expect = 0.33
 Identities = 15/39 (38%), Positives = 24/39 (61%)
 Frame = +1

Query: 319 SDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPMS 435
           SDP+V++ +      R  T V S + NPVW +HF +P++
Sbjct: 316 SDPYVSVSVAGAVIGR--TYVMSNSENPVWMQHFYVPVA 352


>At1g70810.1 68414.m08168 C2 domain-containing protein similar to
           zinc finger and C2 domain protein GI:9957238 from
           [Arabidopsis thaliana]
          Length = 165

 Score = 30.7 bits (66), Expect = 0.57
 Identities = 18/58 (31%), Positives = 26/58 (44%)
 Frame = +1

Query: 259 MLNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPM 432
           +L + V    +L  +D    SDPFV I +    S +  T V     NP W E  +L +
Sbjct: 7   LLRIRVKRGINLAQRDTLS-SDPFVVITM---GSQKLKTRVVENNCNPEWNEELTLAL 60


>At1g08150.1 68414.m00898 sodium/hydrogen exchanger family protein
           contains InterPro entry IPR006153: Sodium/hydrogen
           exchanger
          Length = 815

 Score = 29.9 bits (64), Expect = 1.00
 Identities = 13/30 (43%), Positives = 19/30 (63%)
 Frame = +2

Query: 152 VGQHAMLSYVQEAFKIGNDKHTQLLTKAEA 241
           VGQH+ + YV+E    G+D  T LL+ A +
Sbjct: 727 VGQHSFVEYVEETVNDGSDTSTLLLSIANS 756


>At5g61900.3 68418.m07767 copine BONZAI1 (BON1) nearly identical to
           BONZAI1 [Arabidopsis thaliana] GI:15487382; contains
           Pfam profile PF00168: C2 domain
          Length = 578

 Score = 28.3 bits (60), Expect = 3.0
 Identities = 22/79 (27%), Positives = 39/79 (49%), Gaps = 5/79 (6%)
 Frame = +1

Query: 262 LNVEVV-EATDLVPKDPNGLSDPFVTIYLMSNSSHRY---NTSVKSGTLNPVWEEHFSLP 429
           ++ E+V   ++L  KD    SDPF+ +  +           T V+   LNP+W+  F L 
Sbjct: 194 ISTEIVFRCSNLESKDLFSKSDPFLVVSKIVEHGTPIPVSKTEVRKNDLNPIWKPVF-LS 252

Query: 430 MSGTVNEDS-LCLEVWDFD 483
           +    ++DS + +E  DF+
Sbjct: 253 VQQVGSKDSPVIIECSDFN 271


>At5g61900.1 68418.m07766 copine BONZAI1 (BON1) nearly identical to
           BONZAI1 [Arabidopsis thaliana] GI:15487382; contains
           Pfam profile PF00168: C2 domain
          Length = 578

 Score = 28.3 bits (60), Expect = 3.0
 Identities = 22/79 (27%), Positives = 39/79 (49%), Gaps = 5/79 (6%)
 Frame = +1

Query: 262 LNVEVV-EATDLVPKDPNGLSDPFVTIYLMSNSSHRY---NTSVKSGTLNPVWEEHFSLP 429
           ++ E+V   ++L  KD    SDPF+ +  +           T V+   LNP+W+  F L 
Sbjct: 194 ISTEIVFRCSNLESKDLFSKSDPFLVVSKIVEHGTPIPVSKTEVRKNDLNPIWKPVF-LS 252

Query: 430 MSGTVNEDS-LCLEVWDFD 483
           +    ++DS + +E  DF+
Sbjct: 253 VQQVGSKDSPVIIECSDFN 271


>At3g47220.1 68416.m05127 phosphoinositide-specific phospholipase C
           family protein contains Pfam profile: PF00388
           phosphatidylinositol-specific phospholipase C
          Length = 531

 Score = 27.9 bits (59), Expect = 4.0
 Identities = 12/38 (31%), Positives = 22/38 (57%)
 Frame = +1

Query: 370 NTSVKSGTLNPVWEEHFSLPMSGTVNEDSLCLEVWDFD 483
           NT+VK+    P W E F+ P++   +   +  EV+D++
Sbjct: 448 NTTVKNNEWKPTWGEEFTFPLT-YPDLALISFEVYDYE 484


>At2g40950.1 68415.m05056 bZIP transcription factor family protein
           similar to AtbZIP transcription factor GI:17065880 from
           [Arabidopsis thaliana]; contains Pfam profile: bZIP
           transcription factor PF00170
          Length = 721

 Score = 27.9 bits (59), Expect = 4.0
 Identities = 14/51 (27%), Positives = 24/51 (47%)
 Frame = +1

Query: 343 LMSNSSHRYNTSVKSGTLNPVWEEHFSLPMSGTVNEDSLCLEVWDFDPAET 495
           L S S+      VK+   N   ++ F   ++G +    +C EV+ FD + T
Sbjct: 549 LSSGSADTLKDQVKTKAANGEMQQWFREGVAGPMFSSGMCTEVFQFDVSST 599


>At1g08860.1 68414.m00987 copine, putative Similar to BONZAI1
           [Arabidopsis thaliana] GI:15487382; contains Pfam
           profile PF00168: C2 domain
          Length = 589

 Score = 27.9 bits (59), Expect = 4.0
 Identities = 20/78 (25%), Positives = 32/78 (41%), Gaps = 3/78 (3%)
 Frame = +1

Query: 259 MLNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRY---NTSVKSGTLNPVWEEHFSLP 429
           ++N   + A++L+  D    SDP   +YL            T V    LNP W E  ++ 
Sbjct: 57  LVNQLTLSASNLLDCDITSKSDPMAVMYLRKKDGRLEEIGRTEVILNNLNPKWIEKITVS 116

Query: 430 MSGTVNEDSLCLEVWDFD 483
                 + +L   V+D D
Sbjct: 117 FQFEAVQ-TLVFHVYDVD 133


>At5g58670.1 68418.m07351 phosphoinositide-specific phospholipase C
           (PLC1) identical to phosphoinositide specific
           phospholipase C [Arabidopsis thaliana] GI:902923
          Length = 561

 Score = 27.5 bits (58), Expect = 5.3
 Identities = 14/40 (35%), Positives = 21/40 (52%), Gaps = 1/40 (2%)
 Frame = +1

Query: 367 YNTSVKSGTLNPVWEEHFSLPMSGTVNEDS-LCLEVWDFD 483
           Y T +      P+W++ F  P+   V E S LC+ V D+D
Sbjct: 475 YRTEIDKDEWFPIWDKEFEFPL--RVPELSLLCITVKDYD 512


>At2g20770.1 68415.m02441 lanthionine synthetase C-like family
           protein contains Pfam domain, PF05147: Lanthionine
           synthetase C-like protein
          Length = 405

 Score = 27.5 bits (58), Expect = 5.3
 Identities = 11/15 (73%), Positives = 12/15 (80%)
 Frame = -3

Query: 490 LLDRSPTLLSKGNLH 446
           LLDR P LLSKG +H
Sbjct: 356 LLDRGPKLLSKGEMH 370


>At5g14160.1 68418.m01656 F-box family protein contains F-box domain
           Pfam:PF00646
          Length = 352

 Score = 26.6 bits (56), Expect = 9.3
 Identities = 12/44 (27%), Positives = 22/44 (50%)
 Frame = -2

Query: 473 HTSKQRESSFTVPDMGKEKCSSQTGFRVPDFTDVLYRCDEFDIK 342
           +  ++ E+ +T+ D+G + C +  G  +     VLYR   F  K
Sbjct: 80  YNPQEEENVYTIQDLGVDPCLASCGTWLLALFSVLYRKGHFASK 123


>At5g13480.1 68418.m01554 WD-40 repeat family protein similar to
           WD-repeat protein WDC146 (SP:Q9C0J8|) {Homo sapiens};
           contains 3 weak Pfam PF00400: WD domain, G-beta repeats;
          Length = 711

 Score = 26.6 bits (56), Expect = 9.3
 Identities = 14/39 (35%), Positives = 18/39 (46%)
 Frame = -2

Query: 494 VSAGSKSHTSKQRESSFTVPDMGKEKCSSQTGFRVPDFT 378
           V A   +H    R+ SF   D+    CS  T  +V DFT
Sbjct: 199 VKANKTAHKESIRDLSFCKTDLKFCSCSDDTTVKVWDFT 237


>At3g61030.1 68416.m06828 C2 domain-containing protein similar to
           CLB1 [Lycopersicon esculentum] GI:2789434; contains Pfam
           profile PF00168: C2 domain
          Length = 592

 Score = 26.6 bits (56), Expect = 9.3
 Identities = 13/30 (43%), Positives = 19/30 (63%)
 Frame = +1

Query: 394 LNPVWEEHFSLPMSGTVNEDSLCLEVWDFD 483
           LNPVW++ F L +     + SL +EV+D D
Sbjct: 220 LNPVWDQTFELIVEDKETQ-SLTVEVFDKD 248


>At3g60950.1 68416.m06819 C2 domain-containing protein similar to
           CLB1 [Lycopersicon esculentum] GI:2789434; contains Pfam
           profile PF00168: C2 domain
          Length = 592

 Score = 26.6 bits (56), Expect = 9.3
 Identities = 13/30 (43%), Positives = 19/30 (63%)
 Frame = +1

Query: 394 LNPVWEEHFSLPMSGTVNEDSLCLEVWDFD 483
           LNPVW++ F L +     + SL +EV+D D
Sbjct: 220 LNPVWDQTFELIVEDKETQ-SLTVEVFDKD 248


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 11,116,134
Number of Sequences: 28952
Number of extensions: 220907
Number of successful extensions: 683
Number of sequences better than 10.0: 56
Number of HSP's better than 10.0 without gapping: 653
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 673
length of database: 12,070,560
effective HSP length: 76
effective length of database: 9,870,208
effective search space used: 878448512
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).