SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fbVf0106
         (711 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At4g14920.1 68417.m02292 PHD finger transcription factor, putative     30   1.7  
At5g07700.1 68418.m00883 myb family transcription factor (MYB76)...    29   2.3  
At5g25330.1 68418.m03005 hypothetical protein contains Pfam prof...    29   4.0  
At4g37440.1 68417.m05299 expressed protein                             29   4.0  
At2g19150.1 68415.m02235 pectinesterase family protein contains ...    29   4.0  
At5g16980.1 68418.m01989 NADP-dependent oxidoreductase, putative...    28   5.3  
At1g72520.1 68414.m08386 lipoxygenase, putative similar to lipox...    28   5.3  
At1g07220.1 68414.m00768 expressed protein                             28   5.3  
At5g45900.1 68418.m05645 autophagy 7 (APG7) nearly identical to ...    28   7.0  
At5g28250.1 68418.m03425 Ulp1 protease family protein contains P...    28   7.0  
At5g22390.1 68418.m02612 expressed protein                             27   9.3  
At4g10790.1 68417.m01759 UBX domain-containing protein low simil...    27   9.3  
At1g51850.1 68414.m05845 leucine-rich repeat protein kinase, put...    27   9.3  
At1g10930.1 68414.m01255 DNA helicase (RECQl4A) nearly identical...    27   9.3  

>At4g14920.1 68417.m02292 PHD finger transcription factor, putative
          Length = 1055

 Score = 29.9 bits (64), Expect = 1.7
 Identities = 18/50 (36%), Positives = 26/50 (52%), Gaps = 2/50 (4%)
 Frame = +3

Query: 243 GKGSGK--LDP*LRNKDWL*GPGRVGFGREADADRCRVWSMFVRYVRFSE 386
           G GS +  LD   R K +L G G +GFG +   +RC+    + R + F E
Sbjct: 162 GTGSSRKGLDIEKRRKPYLDGSGNIGFGNQGYRNRCK--KKYKRDMNFDE 209


>At5g07700.1 68418.m00883 myb family transcription factor (MYB76)
           contains Pfam profile: PF00249 myb-like DNA-binding
           domain
          Length = 338

 Score = 29.5 bits (63), Expect = 2.3
 Identities = 14/37 (37%), Positives = 18/37 (48%)
 Frame = -3

Query: 412 EAALY*NTNSLKRT*RTNIDQTRHRSASASRPNPTRP 302
           E   Y NT+  KR     ID   H+  ++S PNP  P
Sbjct: 103 EVKNYWNTHLKKRLIDDGIDPVTHKPLASSNPNPVEP 139


>At5g25330.1 68418.m03005 hypothetical protein contains Pfam profile
           PF03267: Arabidopsis protein of unknown function, DUF266
          Length = 366

 Score = 28.7 bits (61), Expect = 4.0
 Identities = 19/63 (30%), Positives = 31/63 (49%), Gaps = 1/63 (1%)
 Frame = -3

Query: 355 DQTRHRSASASRPNPTRPGPQSQSLFRSYGSNLPL-PLPTLFYRLEALHLGDLLRIWVRT 179
           D+   R AS + PNP+   P+  +      ++LPL PL  LF+  ++ H   L  ++V  
Sbjct: 60  DELLLRQASKANPNPSPKFPKKLAFMFLTTNSLPLAPLWELFFN-QSSHHKSLYNVYVHV 118

Query: 178 GAT 170
             T
Sbjct: 119 DPT 121


>At4g37440.1 68417.m05299 expressed protein
          Length = 471

 Score = 28.7 bits (61), Expect = 4.0
 Identities = 15/46 (32%), Positives = 20/46 (43%)
 Frame = -2

Query: 563 GRTESCRSRTKRNRHDLRQEDPRKAGERGSGSSPKRKTIFASVILN 426
           G +   R RT RNR  + +E+      R S   PK   + AS   N
Sbjct: 407 GPSRPVRKRTPRNREIITKEESNPKRRRVSREKPKSNAVMASRFSN 452


>At2g19150.1 68415.m02235 pectinesterase family protein contains
           Pfam profile: PF01095 pectinesterase
          Length = 339

 Score = 28.7 bits (61), Expect = 4.0
 Identities = 13/34 (38%), Positives = 19/34 (55%)
 Frame = +2

Query: 104 ICGGVRILSADLENSGEGCTWRCRAGSYPYPQQV 205
           I GG+  +    ++  EGCT + R G YP P +V
Sbjct: 185 ISGGIDFIFGGAQSIFEGCTLKLRVGIYP-PNEV 217


>At5g16980.1 68418.m01989 NADP-dependent oxidoreductase, putative
           strong similarity to probable NADP-dependent
           oxidoreductase (zeta-crystallin homolog) P1
           [SP|Q39172][gi:886428] and P2 [SP|Q39173][gi:886430],
           Arabidopsis thaliana
          Length = 239

 Score = 28.3 bits (60), Expect = 5.3
 Identities = 11/26 (42%), Positives = 17/26 (65%)
 Frame = -1

Query: 480 RVRIQSET*DDFRECHIKYIQFLRPH 403
           R+RIQ     DF + + K+++FL PH
Sbjct: 172 RIRIQGFVVSDFYDEYSKFLEFLHPH 197


>At1g72520.1 68414.m08386 lipoxygenase, putative similar to
           lipoxygenase gi:1495804 [Solanum tuberosum], gi:1654140
           [Lycopersicon esculentum], GB:CAB56692 [Arabidopsis
           thaliana]
          Length = 926

 Score = 28.3 bits (60), Expect = 5.3
 Identities = 14/33 (42%), Positives = 19/33 (57%)
 Frame = -1

Query: 129 ESIRTPPQMRCSSRSEPYLPSIGFHGTRTLRQK 31
           +S +  P  R    ++PYLPS    G RTLR+K
Sbjct: 215 QSQKDHPSKRILFTNQPYLPSETPSGLRTLREK 247


>At1g07220.1 68414.m00768 expressed protein
          Length = 507

 Score = 28.3 bits (60), Expect = 5.3
 Identities = 16/56 (28%), Positives = 26/56 (46%)
 Frame = -1

Query: 243 LHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRCSSRSEPY 76
           L Y +D  +   +T  G+  EP    H+ P   FS + +  +    ++CS  S PY
Sbjct: 37  LFYKVDDFIAQTKTLAGHNLEPTPW-HIFPRKSFSAATKHSQAYRILQCSYFSCPY 91


>At5g45900.1 68418.m05645 autophagy 7 (APG7) nearly identical to
           autophagy 7 [Arabidopsis thaliana] GI:19912147; contains
           Pfam profile PF00899: ThiF family
          Length = 697

 Score = 27.9 bits (59), Expect = 7.0
 Identities = 13/43 (30%), Positives = 24/43 (55%)
 Frame = -2

Query: 134 PQRVSGHRRKCGALRVPNHISLL*DSMELERSGRKENSSRTSR 6
           P  ++G    CG  +V NH++LL +S+ L+      ++S  +R
Sbjct: 42  PISITGFYGPCGHPQVSNHLTLLSESLPLDEQSLIASTSHGNR 84


>At5g28250.1 68418.m03425 Ulp1 protease family protein contains Pfam
           profile PF02902: Ulp1 protease family, C-terminal
           catalytic domain
          Length = 939

 Score = 27.9 bits (59), Expect = 7.0
 Identities = 13/35 (37%), Positives = 21/35 (60%)
 Frame = -3

Query: 394 NTNSLKRT*RTNIDQTRHRSASASRPNPTRPGPQS 290
           NT  L+R  +  +  TR  +ASA+  N T+P P++
Sbjct: 373 NTVGLRRKQKIPVVDTRTSTASAAAGNGTKPNPEA 407


>At5g22390.1 68418.m02612 expressed protein
          Length = 202

 Score = 27.5 bits (58), Expect = 9.3
 Identities = 12/22 (54%), Positives = 14/22 (63%)
 Frame = +2

Query: 8  ERSGKSFLFCLSVRVPWNPIEG 73
          + S KSFL  LS   PWNP +G
Sbjct: 17 DNSPKSFLDTLSSSSPWNPSKG 38


>At4g10790.1 68417.m01759 UBX domain-containing protein low
           similarity to SP|Q9UNN5 FAS-associated factor 1 (FAF1
           protein) {Homo sapiens}; contains Pfam profile PF00789:
           UBX domain
          Length = 480

 Score = 27.5 bits (58), Expect = 9.3
 Identities = 12/28 (42%), Positives = 18/28 (64%)
 Frame = -1

Query: 543 IAHETKPTRLTAGRSAEGRRTRVRIQSE 460
           I  ++ PT +TA   AE RRT +R++ E
Sbjct: 297 IVEDSSPTLVTARVEAEERRTNLRLREE 324


>At1g51850.1 68414.m05845 leucine-rich repeat protein kinase,
           putative similar to light repressible receptor protein
           kinase [Arabidopsis thaliana] gi|1321686|emb|CAA66376
          Length = 865

 Score = 27.5 bits (58), Expect = 9.3
 Identities = 24/79 (30%), Positives = 38/79 (48%), Gaps = 3/79 (3%)
 Frame = -2

Query: 494 KAGERGSGSSPKRKTIFASVILNIYSF*---GRIILKY*LAKTNITHEHRPDPAPVRIRF 324
           K GE G     K+K++   V+ +I S     G ++L + L K        P P+ ++   
Sbjct: 475 KKGEDGH----KKKSVIVPVVASIASIAVLIGALVLFFILRKKKSPKVEGPPPSYMQA-- 528

Query: 323 PSKPDTPRSSEPILIPKLR 267
            S   +PRSSEP ++ K R
Sbjct: 529 -SDGRSPRSSEPAIVTKNR 546


>At1g10930.1 68414.m01255 DNA helicase (RECQl4A) nearly identical to
           DNA Helicase [Arabidopsis thaliana] GI:11121449
          Length = 1188

 Score = 27.5 bits (58), Expect = 9.3
 Identities = 14/30 (46%), Positives = 18/30 (60%)
 Frame = -1

Query: 171 HLHVHPSPEFSRSAESIRTPPQMRCSSRSE 82
           H H   +P+ S S  S+RTPP  R +SR E
Sbjct: 229 HYHSTSTPQPSVSNFSLRTPPVDRSASRLE 258


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 17,012,178
Number of Sequences: 28952
Number of extensions: 393591
Number of successful extensions: 1343
Number of sequences better than 10.0: 14
Number of HSP's better than 10.0 without gapping: 1266
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1342
length of database: 12,070,560
effective HSP length: 79
effective length of database: 9,783,352
effective search space used: 1535986264
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).