SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fbVf0105
         (697 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At3g52160.1 68416.m05726 beta-ketoacyl-CoA synthase family prote...    29   2.9  
At4g26190.1 68417.m03770 expressed protein                             28   5.1  
At4g29310.1 68417.m04190 expressed protein                             27   9.0  
At1g76910.1 68414.m08953 hypothetical protein                          27   9.0  

>At3g52160.1 68416.m05726 beta-ketoacyl-CoA synthase family protein
           beta-ketoacyl-CoA synthase - Simmondsia
           chinensis,PID:g1045614
          Length = 451

 Score = 29.1 bits (62), Expect = 2.9
 Identities = 15/38 (39%), Positives = 22/38 (57%)
 Frame = +1

Query: 31  LSEDRNLAWSKRAKAGLIQMFSTHRDCESTAYRSFSIK 144
           LS  R   W  RAK  L+Q+  TH+  E T+Y+S  ++
Sbjct: 282 LSSRRIDRW--RAKYQLMQLVRTHKGMEDTSYKSIELR 317


>At4g26190.1 68417.m03770 expressed protein
          Length = 1067

 Score = 28.3 bits (60), Expect = 5.1
 Identities = 10/35 (28%), Positives = 21/35 (60%)
 Frame = +2

Query: 590  FKTRDATSKPIWIAEIDAIGFFLNTCITAPKSGYN 694
            FKT++   KP+++ ++  +   + TCI+  K  Y+
Sbjct: 944  FKTQEKKDKPLFLKDLRRVWDHIGTCISCGKRKYD 978


>At4g29310.1 68417.m04190 expressed protein
          Length = 424

 Score = 27.5 bits (58), Expect = 9.0
 Identities = 15/54 (27%), Positives = 27/54 (50%)
 Frame = -3

Query: 239 IEGSKSNVAMNAWLPQASYPCGNFSGTSC*KLFILKDR*AVLSQSLCVLNIWIK 78
           I G K ++ ++ +  +  + CG  SG    K+ +  D  A LS+++   N W K
Sbjct: 85  ISGKKISLRVSVYAGRTGHTCGVASGKLLGKVEVAVDLAAALSRTVAFHNGWKK 138


>At1g76910.1 68414.m08953 hypothetical protein
          Length = 139

 Score = 27.5 bits (58), Expect = 9.0
 Identities = 16/41 (39%), Positives = 20/41 (48%), Gaps = 5/41 (12%)
 Frame = -3

Query: 275 WRMFVRNIGRADIEG-SKSNVAMNA----WLPQASYPCGNF 168
           W   V NIGR  + G   S + M+A    WL  A   CG+F
Sbjct: 35  WTETVTNIGRCRVSGRGGSELGMSASGNRWLATAKNSCGSF 75


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 15,493,227
Number of Sequences: 28952
Number of extensions: 321532
Number of successful extensions: 819
Number of sequences better than 10.0: 4
Number of HSP's better than 10.0 without gapping: 805
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 819
length of database: 12,070,560
effective HSP length: 79
effective length of database: 9,783,352
effective search space used: 1487069504
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).