SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fbVf0103
         (685 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At5g02870.1 68418.m00230 60S ribosomal protein L4/L1 (RPL4D) 60S...    29   3.8  
At3g09630.1 68416.m01142 60S ribosomal protein L4/L1 (RPL4A) str...    29   3.8  
At2g45560.1 68415.m05665 cytochrome P450 family protein                29   3.8  
At5g16980.1 68418.m01989 NADP-dependent oxidoreductase, putative...    28   5.0  

>At5g02870.1 68418.m00230 60S ribosomal protein L4/L1 (RPL4D) 60S
           roibosomal protein L4, Arabidopsis thaliana,
           EMBL:CAA79104
          Length = 407

 Score = 28.7 bits (61), Expect = 3.8
 Identities = 9/37 (24%), Positives = 22/37 (59%)
 Frame = -3

Query: 449 IVTPAVYPRLLEFLHVDIQSTGQKSHCVNTREGHRNA 339
           ++T  V P ++ F+H  I +  ++ + V+ + GH+ +
Sbjct: 33  VMTAPVRPDIVNFVHAQISNNSRQPYAVSKKAGHQTS 69


>At3g09630.1 68416.m01142 60S ribosomal protein L4/L1 (RPL4A) strong
           similarity to 60S ribosomal protein L1 GB:P49691
          Length = 406

 Score = 28.7 bits (61), Expect = 3.8
 Identities = 9/37 (24%), Positives = 22/37 (59%)
 Frame = -3

Query: 449 IVTPAVYPRLLEFLHVDIQSTGQKSHCVNTREGHRNA 339
           ++T  V P ++ F+H  I +  ++ + V+ + GH+ +
Sbjct: 32  VMTAPVRPDIVNFVHAQISNNSRQPYAVSKKAGHQTS 68


>At2g45560.1 68415.m05665 cytochrome P450 family protein
          Length = 512

 Score = 28.7 bits (61), Expect = 3.8
 Identities = 19/53 (35%), Positives = 25/53 (47%)
 Frame = +2

Query: 29  GREADAAGAGSGRCSCVMFVLAS*YFNIMRPQKLYIFNMTLAKIVLRFGLDPD 187
           GR+ +    G+GR  C    LA    ++M    LY F+  L K VL   LD D
Sbjct: 435 GRDYELTPFGAGRRICPGMPLAMKTVSLMLASLLYSFDWKLPKGVLSEDLDMD 487


>At5g16980.1 68418.m01989 NADP-dependent oxidoreductase, putative
           strong similarity to probable NADP-dependent
           oxidoreductase (zeta-crystallin homolog) P1
           [SP|Q39172][gi:886428] and P2 [SP|Q39173][gi:886430],
           Arabidopsis thaliana
          Length = 239

 Score = 28.3 bits (60), Expect = 5.0
 Identities = 11/26 (42%), Positives = 17/26 (65%)
 Frame = -1

Query: 190 RVRIQSET*DDFRECHIKYIQFLRPH 113
           R+RIQ     DF + + K+++FL PH
Sbjct: 172 RIRIQGFVVSDFYDEYSKFLEFLHPH 197


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 14,578,764
Number of Sequences: 28952
Number of extensions: 285283
Number of successful extensions: 687
Number of sequences better than 10.0: 4
Number of HSP's better than 10.0 without gapping: 668
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 687
length of database: 12,070,560
effective HSP length: 79
effective length of database: 9,783,352
effective search space used: 1447936096
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).