SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fbVf0101
         (509 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At3g42540.1 68416.m04412 hypothetical protein                          31   0.60 
At1g67340.1 68414.m07665 zinc finger (MYND type) family protein ...    30   1.0  
At3g55780.1 68416.m06198 glycosyl hydrolase family 17 protein si...    29   1.4  
At5g64380.1 68418.m08087 fructose-1,6-bisphosphatase family prot...    29   2.4  
At2g47390.1 68415.m05915 expressed protein                             29   2.4  
At3g62370.1 68416.m07006 expressed protein                             28   4.2  
At5g40720.1 68418.m04942 expressed protein contains Pfam profile...    27   5.5  
At3g48000.1 68416.m05233 aldehyde dehydrogenase (ALDH2) identica...    27   5.5  
At3g47910.1 68416.m05224 expressed protein low similarity to non...    27   5.5  
At3g11590.1 68416.m01416 expressed protein                             27   5.5  
At1g77240.1 68414.m08996 AMP-binding protein, putative strong si...    27   5.5  
At1g36150.1 68414.m04494 protease inhibitor/seed storage/lipid t...    27   5.5  
At5g11190.1 68418.m01308 AP2 domain-containing transcription fac...    27   7.3  
At2g28510.1 68415.m03464 Dof-type zinc finger domain-containing ...    27   7.3  
At1g01040.1 68414.m00004 DEAD/DEAH box helicase carpel factory /...    27   7.3  
At1g15030.1 68414.m01796 expressed protein                             27   9.7  

>At3g42540.1 68416.m04412 hypothetical protein 
          Length = 208

 Score = 30.7 bits (66), Expect = 0.60
 Identities = 18/51 (35%), Positives = 25/51 (49%)
 Frame = +2

Query: 158 TAKGTGLGESAGKADPVELDSSLAL*GDMRGVDKWEIXSRDRRWKTTTFIV 310
           T +G  LG   G+ D   L   L + GD+ G D W   S D+ WK   +I+
Sbjct: 52  TVRGDSLGAQRGRCD---LLLGLKI-GDLPGSDCWNHASGDKIWKNIMWII 98


>At1g67340.1 68414.m07665 zinc finger (MYND type) family protein /
           F-box family protein
          Length = 379

 Score = 29.9 bits (64), Expect = 1.0
 Identities = 18/46 (39%), Positives = 24/46 (52%)
 Frame = -3

Query: 399 SPLCTLGTTHRAPADIIDRAPLPPNRVSNETMKVVVFQRRSREXIS 262
           S LC LG+T R PAD I+   L   R+    M  +V  R S + I+
Sbjct: 54  SILCKLGSTSRCPADFIN-VLLTCKRLKGLAMNPIVLSRLSPKAIA 98


>At3g55780.1 68416.m06198 glycosyl hydrolase family 17 protein
           similar to beta-1,3-glucanase precursor GI:4097948 from
           [Oryza sativa]
          Length = 429

 Score = 29.5 bits (63), Expect = 1.4
 Identities = 12/42 (28%), Positives = 22/42 (52%)
 Frame = -3

Query: 423 TATSVSATSPLCTLGTTHRAPADIIDRAPLPPNRVSNETMKV 298
           TA +   T+   T+G T+  PA I     L P+R++ + + +
Sbjct: 18  TAIATPTTTSATTIGVTYSTPASISGTVQLSPDRIAEKVVSM 59


>At5g64380.1 68418.m08087 fructose-1,6-bisphosphatase family protein
           similar to SP|P22418 Fructose-1,6-bisphosphatase,
           chloroplast precursor (EC 3.1.3.11)
           (D-fructose-1,6-bisphosphate 1-phosphohydrolase)
           (FBPase) {Spinacia oleracea}; contains Pfam profile
           PF00316: fructose-1,6-bisphosphatase
          Length = 404

 Score = 28.7 bits (61), Expect = 2.4
 Identities = 19/70 (27%), Positives = 31/70 (44%)
 Frame = -3

Query: 354 IIDRAPLPPNRVSNETMKVVVFQRRSREXISHLSTPLMSPYNARLESSSTGSAFPADSPK 175
           +ID A        N    +VV     +     +++ + SP+N+ L   S  S+  +D   
Sbjct: 72  LIDFAGSGGGEGKNVGEDLVVLLYHLQHACKRIASLVASPFNSSLGKLSVNSSSGSDRDA 131

Query: 174 PVPLAVVSLD 145
           P PL +VS D
Sbjct: 132 PKPLDIVSND 141


>At2g47390.1 68415.m05915 expressed protein
          Length = 961

 Score = 28.7 bits (61), Expect = 2.4
 Identities = 16/63 (25%), Positives = 31/63 (49%), Gaps = 4/63 (6%)
 Frame = -3

Query: 423 TATSVSATSPLCTLGTTHRAPA----DIIDRAPLPPNRVSNETMKVVVFQRRSREXISHL 256
           +A++ +       +GT +R P     DI+D  P+P    S    K++  +RR+   ++ L
Sbjct: 93  SASATATEDDELAIGTGYRLPPPEIRDIVDAPPVPALSFSPHRDKILFLKRRALPPLADL 152

Query: 255 STP 247
           + P
Sbjct: 153 ARP 155


>At3g62370.1 68416.m07006 expressed protein
          Length = 361

 Score = 27.9 bits (59), Expect = 4.2
 Identities = 13/34 (38%), Positives = 19/34 (55%), Gaps = 2/34 (5%)
 Frame = -2

Query: 472 NSPPGSVL--EPDHAGVLNGDERFRHVTTLHAWN 377
           N+ PG +    P   G  NG +RF H+  ++AWN
Sbjct: 160 NAIPGRLYGGNPIDNGEGNGGDRFGHLVDIYAWN 193


>At5g40720.1 68418.m04942 expressed protein contains Pfam profile
           PF01697: Domain of unknown function
          Length = 583

 Score = 27.5 bits (58), Expect = 5.5
 Identities = 13/44 (29%), Positives = 22/44 (50%)
 Frame = -1

Query: 452 PRTGSRGSFKRRRAFPPRHHSARLERHTVRPPILSTVHRFRPTE 321
           PR+G   ++  R A P RH S  +   ++   +++ VH F   E
Sbjct: 412 PRSGVTAAYTCRMALPERHKSI-IRPESLNATLINVVHHFHLKE 454


>At3g48000.1 68416.m05233 aldehyde dehydrogenase (ALDH2) identical
           to aldehyde dehydrogenase [Arabidopsis thaliana]
           GI:8574427; similar to mitochondrial aldehyde
           dehydrogenase [Arabidopsis thaliana]
           gi|19850249|gb|AAL99612; identical to cDNA aldehyde
           dehydrogenase AtALDH2a GI:20530140
          Length = 538

 Score = 27.5 bits (58), Expect = 5.5
 Identities = 20/68 (29%), Positives = 35/68 (51%), Gaps = 4/68 (5%)
 Frame = +3

Query: 156 PQPRERAWENQRGKQTLLSLTLVWHCKE--T*EV*ISGRSFR-AIVAGKPLLS-LFHYLL 323
           P P+  A+E  R       L +  H +E  + E   +G+ ++ ++ A  P+ + LF Y  
Sbjct: 112 PWPKMSAYERSRVLLRFADL-VEKHSEELASLETWDNGKPYQQSLTAEIPMFARLFRYYA 170

Query: 324 GWAEAVHG 347
           GWA+ +HG
Sbjct: 171 GWADKIHG 178


>At3g47910.1 68416.m05224 expressed protein low similarity to
            nonmuscle myosin heavy chain (NMHC) [Homo sapiens]
            GI:189036; contains Pfam profiles PF04780: Protein of
            unknown function (DUF629), PF04781: Protein of unknown
            function (DUF627)
          Length = 1290

 Score = 27.5 bits (58), Expect = 5.5
 Identities = 11/32 (34%), Positives = 20/32 (62%)
 Frame = -3

Query: 387  TLGTTHRAPADIIDRAPLPPNRVSNETMKVVV 292
            T+G+ HR+ AD ++ +PLP   V + +   +V
Sbjct: 972  TIGSDHRSNADSVEHSPLPVAPVGDHSEADIV 1003


>At3g11590.1 68416.m01416 expressed protein
          Length = 622

 Score = 27.5 bits (58), Expect = 5.5
 Identities = 12/21 (57%), Positives = 14/21 (66%)
 Frame = -3

Query: 261 HLSTPLMSPYNARLESSSTGS 199
           HLS P  SP + R+E S TGS
Sbjct: 150 HLSDPSHSPVSERMERSGTGS 170


>At1g77240.1 68414.m08996 AMP-binding protein, putative strong
           similarity to AMP-binding protein GI:1903034 from
           [Brassica napus]; contains Pfam AMP-binding domain
           PF00501
          Length = 545

 Score = 27.5 bits (58), Expect = 5.5
 Identities = 16/41 (39%), Positives = 23/41 (56%), Gaps = 2/41 (4%)
 Frame = -2

Query: 487 VPPQSNSPPGSVLE-PDHAGVLNGDE-RFRHVTTLHAWNDT 371
           +P  SNS P +VL   + A  + GD     H TT+H W++T
Sbjct: 5   LPHASNSCPLTVLGFLERAASVFGDSPSLLHTTTVHTWSET 45


>At1g36150.1 68414.m04494 protease inhibitor/seed storage/lipid
           transfer protein (LTP) family protein low similarity to
           glucoamylase S1/S2 [Precursor] from Saccharomyces
           cerevisiae [SP|P08640], proteophosphoglycan from
           Leishmania major [GI:5420387]; contains Pfam protease
           inhibitor/seed storage/LTP family domain PF00234
          Length = 256

 Score = 27.5 bits (58), Expect = 5.5
 Identities = 16/44 (36%), Positives = 22/44 (50%)
 Frame = -3

Query: 282 RSREXISHLSTPLMSPYNARLESSSTGSAFPADSPKPVPLAVVS 151
           RS   +SH S  + +    +  SSST S+  A SP P P   +S
Sbjct: 188 RSSPAVSHSSPVVAASSPVKAVSSSTASSPRAASPSPSPSPSIS 231


>At5g11190.1 68418.m01308 AP2 domain-containing transcription
           factor, putative [Arabidopsis thaliana]
          Length = 189

 Score = 27.1 bits (57), Expect = 7.3
 Identities = 25/92 (27%), Positives = 42/92 (45%), Gaps = 3/92 (3%)
 Frame = -3

Query: 384 LGT--THRAPADIIDRAPLPPNRVSNETMKVVVFQRRSREXISHLSTPLMSPYN-ARLES 214
           LGT  T  A A   D+A L  N  + +T   VV      + +  +++PLMSP + + L +
Sbjct: 33  LGTFETAEAAARAYDQAALLMNGQNAKTNFPVVKSEEGSDHVKDVNSPLMSPKSLSELLN 92

Query: 213 SSTGSAFPADSPKPVPLAVVSLDSR*GQWESR 118
           +    +    +P    L + +  S  G W+ R
Sbjct: 93  AKLRKSCKDLTPSLTCLRLDTDSSHIGVWQKR 124


>At2g28510.1 68415.m03464 Dof-type zinc finger domain-containing
           protein similar to elicitor-responsive Dof protein ERDP
           GI:6092016 from [Pisum sativum]
          Length = 288

 Score = 27.1 bits (57), Expect = 7.3
 Identities = 23/80 (28%), Positives = 31/80 (38%), Gaps = 3/80 (3%)
 Frame = +1

Query: 274 ARSSLENHYFHCFITYSVGRKRCTVDNIG---GRTVCRSKRAEW*RGGNARRRLKLPRDP 444
           +R  L     +C    S   K C  +N      R  C+S R  W +GG  R        P
Sbjct: 39  SRGELGGEAQNCPRCESPNTKFCYYNNYSLSQPRYFCKSCRRYWTKGGTLR------NVP 92

Query: 445 VRGHCQAGSLTGAVHLSKNN 504
           V G C+    + +   SKNN
Sbjct: 93  VGGGCRRNKRSSSSAFSKNN 112


>At1g01040.1 68414.m00004 DEAD/DEAH box helicase carpel factory /
           CAF identical to RNA helicase/RNAseIII CAF protein
           GB:AAF03534 GI:6102610 from [Arabidopsis thaliana]
          Length = 1909

 Score = 27.1 bits (57), Expect = 7.3
 Identities = 13/44 (29%), Positives = 22/44 (50%)
 Frame = +3

Query: 69  GSQMPRHLISDAHEWINEIPTVPIYYLAKPQPRERAWENQRGKQ 200
           G  +P + +SD +  INE+   P   +AK   +E   +   GK+
Sbjct: 70  GGGLPNNGVSDTNSQINEVTVTP-QVIAKETVKENGLQKNGGKR 112


>At1g15030.1 68414.m01796 expressed protein
          Length = 360

 Score = 26.6 bits (56), Expect = 9.7
 Identities = 17/59 (28%), Positives = 30/59 (50%), Gaps = 6/59 (10%)
 Frame = +3

Query: 69  GSQMPRHLISDA-----HEWINEI-PTVPIYYLAKPQPRERAWENQRGKQTLLSLTLVW 227
           GS + +H +S+A       +++ + P+VP +YL+K   RER   +   +     L  VW
Sbjct: 33  GSALLKHHVSEASSSNVERFLDSVTPSVPAHYLSKTIVRERGGSDVESQVPYFLLGDVW 91


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 11,506,369
Number of Sequences: 28952
Number of extensions: 242567
Number of successful extensions: 677
Number of sequences better than 10.0: 16
Number of HSP's better than 10.0 without gapping: 665
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 677
length of database: 12,070,560
effective HSP length: 76
effective length of database: 9,870,208
effective search space used: 917929344
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).