SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fbVf0100
         (644 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At5g64380.1 68418.m08087 fructose-1,6-bisphosphatase family prot...    29   2.6  
At1g77240.1 68414.m08996 AMP-binding protein, putative strong si...    29   3.5  
At4g30980.1 68417.m04397 basic helix-loop-helix (bHLH) family pr...    28   4.6  
At4g05190.1 68417.m00781 kinesin-like protein A, putative kinesi...    28   6.1  
At3g62370.1 68416.m07006 expressed protein                             28   6.1  
At5g05360.2 68418.m00577 expressed protein similar to unknown pr...    27   8.1  
At5g05360.1 68418.m00578 expressed protein similar to unknown pr...    27   8.1  
At4g37450.1 68417.m05301 arabinogalactan-protein (AGP18) identic...    27   8.1  

>At5g64380.1 68418.m08087 fructose-1,6-bisphosphatase family protein
           similar to SP|P22418 Fructose-1,6-bisphosphatase,
           chloroplast precursor (EC 3.1.3.11)
           (D-fructose-1,6-bisphosphate 1-phosphohydrolase)
           (FBPase) {Spinacia oleracea}; contains Pfam profile
           PF00316: fructose-1,6-bisphosphatase
          Length = 404

 Score = 29.1 bits (62), Expect = 2.6
 Identities = 15/37 (40%), Positives = 21/37 (56%)
 Frame = -3

Query: 144 ATPLMSPYNARLESSSTGSSFPADSPKPVPLAVVSLD 34
           A+ + SP+N+ L   S  SS  +D   P PL +VS D
Sbjct: 105 ASLVASPFNSSLGKLSVNSSSGSDRDAPKPLDIVSND 141


>At1g77240.1 68414.m08996 AMP-binding protein, putative strong
           similarity to AMP-binding protein GI:1903034 from
           [Brassica napus]; contains Pfam AMP-binding domain
           PF00501
          Length = 545

 Score = 28.7 bits (61), Expect = 3.5
 Identities = 17/41 (41%), Positives = 23/41 (56%), Gaps = 2/41 (4%)
 Frame = -2

Query: 376 VPPQSNSPPGSVLE-PDHAGVLNGDE-RFRHVTTLHAWNET 260
           +P  SNS P +VL   + A  + GD     H TT+H W+ET
Sbjct: 5   LPHASNSCPLTVLGFLERAASVFGDSPSLLHTTTVHTWSET 45


>At4g30980.1 68417.m04397 basic helix-loop-helix (bHLH) family
           protein contains Pfam profile: PF00010 helix-loop-helix
           DNA-binding domain
          Length = 310

 Score = 28.3 bits (60), Expect = 4.6
 Identities = 8/19 (42%), Positives = 13/19 (68%)
 Frame = -2

Query: 277 HAWNETPWPADIIDRAPLP 221
           H ++ TPWP+ ++D  P P
Sbjct: 31  HIFSSTPWPSSVLDDTPPP 49


>At4g05190.1 68417.m00781 kinesin-like protein A, putative kinesin
           like protein A, Arabidopsis thaliana, gb:Q07970
          Length = 790

 Score = 27.9 bits (59), Expect = 6.1
 Identities = 11/27 (40%), Positives = 16/27 (59%)
 Frame = -2

Query: 238 DRAPLPPNRVSNETMKVVVFQRRSRET 158
           +RAPLP   V  E +  + F +R +ET
Sbjct: 7   NRAPLPSPNVKKEALSSIPFDKRRKET 33


>At3g62370.1 68416.m07006 expressed protein
          Length = 361

 Score = 27.9 bits (59), Expect = 6.1
 Identities = 13/34 (38%), Positives = 19/34 (55%), Gaps = 2/34 (5%)
 Frame = -2

Query: 361 NSPPGSVL--EPDHAGVLNGDERFRHVTTLHAWN 266
           N+ PG +    P   G  NG +RF H+  ++AWN
Sbjct: 160 NAIPGRLYGGNPIDNGEGNGGDRFGHLVDIYAWN 193


>At5g05360.2 68418.m00577 expressed protein similar to unknown
           protein (pir||T02500)
          Length = 153

 Score = 27.5 bits (58), Expect = 8.1
 Identities = 13/37 (35%), Positives = 21/37 (56%)
 Frame = -2

Query: 229 PLPPNRVSNETMKVVVFQRRSRETISHLCYTSHVSLQ 119
           P  P+R S      V  ++ +R+T SHL Y++ V L+
Sbjct: 20  PTRPHRPSPSPRNKVFVKKTTRDTTSHLDYSNLVKLE 56


>At5g05360.1 68418.m00578 expressed protein similar to unknown
           protein (pir||T02500)
          Length = 163

 Score = 27.5 bits (58), Expect = 8.1
 Identities = 13/37 (35%), Positives = 21/37 (56%)
 Frame = -2

Query: 229 PLPPNRVSNETMKVVVFQRRSRETISHLCYTSHVSLQ 119
           P  P+R S      V  ++ +R+T SHL Y++ V L+
Sbjct: 20  PTRPHRPSPSPRNKVFVKKTTRDTTSHLDYSNLVKLE 56


>At4g37450.1 68417.m05301 arabinogalactan-protein (AGP18) identical
           to gi_11935088_gb_AAG41964
          Length = 209

 Score = 27.5 bits (58), Expect = 8.1
 Identities = 13/37 (35%), Positives = 22/37 (59%), Gaps = 1/37 (2%)
 Frame = -3

Query: 156 SPTYATPLMSPYNARLESSSTGSSFPADSPK-PVPLA 49
           SPT +  + SP  A  ++ +  +S P +SPK P P++
Sbjct: 41  SPTKSPAVTSPTTAPAKTPTASASSPVESPKSPAPVS 77


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 14,612,052
Number of Sequences: 28952
Number of extensions: 317389
Number of successful extensions: 899
Number of sequences better than 10.0: 8
Number of HSP's better than 10.0 without gapping: 869
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 899
length of database: 12,070,560
effective HSP length: 78
effective length of database: 9,812,304
effective search space used: 1334473344
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).