SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fbVf0099
         (684 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At4g05190.1 68417.m00781 kinesin-like protein A, putative kinesi...    35   0.044
At5g64380.1 68418.m08087 fructose-1,6-bisphosphatase family prot...    29   2.2  
At3g17770.1 68416.m02267 dihydroxyacetone kinase family protein ...    29   2.2  
At1g48430.1 68414.m05414 dihydroxyacetone kinase family protein ...    29   2.2  
At3g52160.1 68416.m05726 beta-ketoacyl-CoA synthase family prote...    29   2.9  
At4g27520.1 68417.m03952 plastocyanin-like domain-containing pro...    29   3.8  
At1g77240.1 68414.m08996 AMP-binding protein, putative strong si...    29   3.8  
At4g37450.1 68417.m05301 arabinogalactan-protein (AGP18) identic...    28   5.0  
At3g55780.1 68416.m06198 glycosyl hydrolase family 17 protein si...    28   5.0  
At5g27070.1 68418.m03230 MADS-box family protein contains Pfam p...    28   6.6  
At3g62370.1 68416.m07006 expressed protein                             28   6.6  
At5g04810.1 68418.m00503 pentatricopeptide (PPR) repeat-containi...    27   8.8  
At3g47910.1 68416.m05224 expressed protein low similarity to non...    27   8.8  
At1g01040.1 68414.m00004 DEAD/DEAH box helicase carpel factory /...    27   8.8  

>At4g05190.1 68417.m00781 kinesin-like protein A, putative kinesin
           like protein A, Arabidopsis thaliana, gb:Q07970
          Length = 790

 Score = 35.1 bits (77), Expect = 0.044
 Identities = 17/51 (33%), Positives = 27/51 (52%)
 Frame = -1

Query: 336 DRAPLPPNRVSNETMKVVVFQRRSRETTPTYATPLMSPYNARLESSSTGSS 184
           +RAPLP   V  E +  + F +R +ET  T    ++S  N +  +S  GS+
Sbjct: 7   NRAPLPSPNVKKEALSSIPFDKRRKETQGTGRRQVLSTVNRQDANSDVGST 57


>At5g64380.1 68418.m08087 fructose-1,6-bisphosphatase family protein
           similar to SP|P22418 Fructose-1,6-bisphosphatase,
           chloroplast precursor (EC 3.1.3.11)
           (D-fructose-1,6-bisphosphate 1-phosphohydrolase)
           (FBPase) {Spinacia oleracea}; contains Pfam profile
           PF00316: fructose-1,6-bisphosphatase
          Length = 404

 Score = 29.5 bits (63), Expect = 2.2
 Identities = 21/70 (30%), Positives = 30/70 (42%)
 Frame = -1

Query: 342 IIDRAPLPPNRVSNETMKVVVFQRRSRETTPTYATPLMSPYNARLESSSTGSSFPADSPK 163
           +ID A        N    +VV     +      A+ + SP+N+ L   S  SS  +D   
Sbjct: 72  LIDFAGSGGGEGKNVGEDLVVLLYHLQHACKRIASLVASPFNSSLGKLSVNSSSGSDRDA 131

Query: 162 PVPLAVVSLD 133
           P PL +VS D
Sbjct: 132 PKPLDIVSND 141


>At3g17770.1 68416.m02267 dihydroxyacetone kinase family protein
           contains Pfam domains, PF02733: DAK1 domain and PF02734:
           DAK2 domain
          Length = 595

 Score = 29.5 bits (63), Expect = 2.2
 Identities = 19/61 (31%), Positives = 26/61 (42%)
 Frame = -2

Query: 518 SLSCLRTPALFVDRCTAPVKLPAWQCPRTGSRGSFKRRRAFPPRHHSARLERNTVRPPIL 339
           S+S ++     +DR  AP K P W     G+R   K     PP      +E  + RP  L
Sbjct: 318 SISIMKADHSILDRLDAPTKAPNWPVGTDGNRPPAKIPVPVPPSRSIKSMESQS-RPLEL 376

Query: 338 S 336
           S
Sbjct: 377 S 377


>At1g48430.1 68414.m05414 dihydroxyacetone kinase family protein
           similar to dihydroxyacetone kinases; contains Pfam
           profiles PF02733:  DAK1 domain, PF02734: DAK2 domain
          Length = 593

 Score = 29.5 bits (63), Expect = 2.2
 Identities = 20/65 (30%), Positives = 28/65 (43%)
 Frame = -2

Query: 518 SLSCLRTPALFVDRCTAPVKLPAWQCPRTGSRGSFKRRRAFPPRHHSARLERNTVRPPIL 339
           S+S ++     ++R  AP   P+W     GSR   K     P R  S + E +  RP  L
Sbjct: 318 SISIMKADQSILERLDAPTNAPSWPVGTDGSRPPAKIPVPLPFR--STKNEESRYRPQEL 375

Query: 338 STAHR 324
           S   R
Sbjct: 376 SQQGR 380


>At3g52160.1 68416.m05726 beta-ketoacyl-CoA synthase family protein
           beta-ketoacyl-CoA synthase - Simmondsia
           chinensis,PID:g1045614
          Length = 451

 Score = 29.1 bits (62), Expect = 2.9
 Identities = 15/38 (39%), Positives = 22/38 (57%)
 Frame = +1

Query: 511 LSEDRNLAWSKRAKAGLIQMFSTHRDCESTAYRSFSIK 624
           LS  R   W  RAK  L+Q+  TH+  E T+Y+S  ++
Sbjct: 282 LSSRRIDRW--RAKYQLMQLVRTHKGMEDTSYKSIELR 317


>At4g27520.1 68417.m03952 plastocyanin-like domain-containing
           protein similar to PIR|JC7196 phytocyanin-related
           protein Pn14 {Ipomoea nil}; contains Pfam profile
           PF02298: Plastocyanin-like domain
          Length = 349

 Score = 28.7 bits (61), Expect = 3.8
 Identities = 27/95 (28%), Positives = 40/95 (42%), Gaps = 9/95 (9%)
 Frame = -1

Query: 411 TATSVS-ATSPLCTLGTKHRAPADIIDRAPLPPNRVS-------NETMKVVVFQRRSRET 256
           ++++VS ATSP  ++  K  +P       P PP   S         T        +S  T
Sbjct: 189 SSSAVSPATSPPGSMAPKSGSPVSPTTSPPAPPKSTSPVSPSSAPMTSPPAPMAPKSSST 248

Query: 255 TPTYATPLMSPYNARL-ESSSTGSSFPADSPKPVP 154
            P  + P+ SP  +   +SSS  S+ P  SP   P
Sbjct: 249 IPPSSAPMTSPPGSMAPKSSSPVSNSPTVSPSLAP 283


>At1g77240.1 68414.m08996 AMP-binding protein, putative strong
           similarity to AMP-binding protein GI:1903034 from
           [Brassica napus]; contains Pfam AMP-binding domain
           PF00501
          Length = 545

 Score = 28.7 bits (61), Expect = 3.8
 Identities = 17/41 (41%), Positives = 23/41 (56%), Gaps = 2/41 (4%)
 Frame = -3

Query: 475 VPPQSNSPPGSVLE-PDHAGVLNGDE-RFRHVTTLHAWNET 359
           +P  SNS P +VL   + A  + GD     H TT+H W+ET
Sbjct: 5   LPHASNSCPLTVLGFLERAASVFGDSPSLLHTTTVHTWSET 45


>At4g37450.1 68417.m05301 arabinogalactan-protein (AGP18) identical
           to gi_11935088_gb_AAG41964
          Length = 209

 Score = 28.3 bits (60), Expect = 5.0
 Identities = 13/38 (34%), Positives = 23/38 (60%), Gaps = 1/38 (2%)
 Frame = -1

Query: 258 TTPTYATPLMSPYNARLESSSTGSSFPADSPK-PVPLA 148
           T+PT +  + SP  A  ++ +  +S P +SPK P P++
Sbjct: 40  TSPTKSPAVTSPTTAPAKTPTASASSPVESPKSPAPVS 77


>At3g55780.1 68416.m06198 glycosyl hydrolase family 17 protein
           similar to beta-1,3-glucanase precursor GI:4097948 from
           [Oryza sativa]
          Length = 429

 Score = 28.3 bits (60), Expect = 5.0
 Identities = 13/54 (24%), Positives = 26/54 (48%)
 Frame = -1

Query: 411 TATSVSATSPLCTLGTKHRAPADIIDRAPLPPNRVSNETMKVVVFQRRSRETTP 250
           TA +   T+   T+G  +  PA I     L P+R++ + + + +   R  ++ P
Sbjct: 18  TAIATPTTTSATTIGVTYSTPASISGTVQLSPDRIAEKVVSMNIPAVRLLDSNP 71


>At5g27070.1 68418.m03230 MADS-box family protein contains Pfam
           profile PF00319: SRF-type transcription factor
           (DNA-binding and dimerisation domain); MADS-box protein
           AGL53
          Length = 287

 Score = 27.9 bits (59), Expect = 6.6
 Identities = 18/63 (28%), Positives = 28/63 (44%), Gaps = 1/63 (1%)
 Frame = -1

Query: 402 SVSATSPLCTLGTKHRAPADIIDRAPLP-PNRVSNETMKVVVFQRRSRETTPTYATPLMS 226
           SVS+      LG +        D  P+  P ++  +T  V   Q  +    P++A P+M 
Sbjct: 225 SVSSFDQSALLGEQGSGLGSNFDLPPMVFPPQMQTQTPLVPFDQFAAWNQAPSFADPMMF 284

Query: 225 PYN 217
           PYN
Sbjct: 285 PYN 287


>At3g62370.1 68416.m07006 expressed protein
          Length = 361

 Score = 27.9 bits (59), Expect = 6.6
 Identities = 13/34 (38%), Positives = 19/34 (55%), Gaps = 2/34 (5%)
 Frame = -3

Query: 460 NSPPGSVL--EPDHAGVLNGDERFRHVTTLHAWN 365
           N+ PG +    P   G  NG +RF H+  ++AWN
Sbjct: 160 NAIPGRLYGGNPIDNGEGNGGDRFGHLVDIYAWN 193


>At5g04810.1 68418.m00503 pentatricopeptide (PPR) repeat-containing
           protein contains Pfam profile: PF01535 PPR repeat
          Length = 952

 Score = 27.5 bits (58), Expect = 8.8
 Identities = 13/37 (35%), Positives = 18/37 (48%)
 Frame = -1

Query: 264 RETTPTYATPLMSPYNARLESSSTGSSFPADSPKPVP 154
           ++  P    P  SP + R    S GSS  + SP P+P
Sbjct: 36  KQPPPQPPEPPESPPDLRRPEKSIGSSSSSSSPSPIP 72


>At3g47910.1 68416.m05224 expressed protein low similarity to
            nonmuscle myosin heavy chain (NMHC) [Homo sapiens]
            GI:189036; contains Pfam profiles PF04780: Protein of
            unknown function (DUF629), PF04781: Protein of unknown
            function (DUF627)
          Length = 1290

 Score = 27.5 bits (58), Expect = 8.8
 Identities = 11/32 (34%), Positives = 20/32 (62%)
 Frame = -1

Query: 375  TLGTKHRAPADIIDRAPLPPNRVSNETMKVVV 280
            T+G+ HR+ AD ++ +PLP   V + +   +V
Sbjct: 972  TIGSDHRSNADSVEHSPLPVAPVGDHSEADIV 1003


>At1g01040.1 68414.m00004 DEAD/DEAH box helicase carpel factory /
           CAF identical to RNA helicase/RNAseIII CAF protein
           GB:AAF03534 GI:6102610 from [Arabidopsis thaliana]
          Length = 1909

 Score = 27.5 bits (58), Expect = 8.8
 Identities = 13/44 (29%), Positives = 22/44 (50%)
 Frame = +3

Query: 57  GSQMPRHLISDAHEWINEIPTVPIYYLAKPQPRERAWENQRGKK 188
           G  +P + +SD +  INE+   P   +AK   +E   +   GK+
Sbjct: 70  GGGLPNNGVSDTNSQINEVTVTP-QVIAKETVKENGLQKNGGKR 112


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 15,504,580
Number of Sequences: 28952
Number of extensions: 341428
Number of successful extensions: 974
Number of sequences better than 10.0: 14
Number of HSP's better than 10.0 without gapping: 944
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 974
length of database: 12,070,560
effective HSP length: 79
effective length of database: 9,783,352
effective search space used: 1447936096
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).