SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fbVf0097
         (620 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At2g46370.2 68415.m05771 auxin-responsive GH3 family protein sim...    29   3.3  
At2g46370.1 68415.m05770 auxin-responsive GH3 family protein sim...    29   3.3  
At1g34610.1 68414.m04301 Ulp1 protease family protein contains P...    27   7.6  

>At2g46370.2 68415.m05771 auxin-responsive GH3 family protein
           similar to auxin-responsive GH3 product [Glycine max]
           GI:18591; contains Pfam profile PF03321: GH3
           auxin-responsive promoter
          Length = 575

 Score = 28.7 bits (61), Expect = 3.3
 Identities = 13/39 (33%), Positives = 20/39 (51%), Gaps = 2/39 (5%)
 Frame = +1

Query: 349 KTQTLDFSLHIGKKLPTGNFEFKWKLWNEDNES--QMCC 459
           K + +DFS +I      G++   W++  E NE   Q CC
Sbjct: 456 KIEVIDFSSYIDVSTDPGHYAIFWEISGETNEDVLQDCC 494


>At2g46370.1 68415.m05770 auxin-responsive GH3 family protein
           similar to auxin-responsive GH3 product [Glycine max]
           GI:18591; contains Pfam profile PF03321: GH3
           auxin-responsive promoter
          Length = 575

 Score = 28.7 bits (61), Expect = 3.3
 Identities = 13/39 (33%), Positives = 20/39 (51%), Gaps = 2/39 (5%)
 Frame = +1

Query: 349 KTQTLDFSLHIGKKLPTGNFEFKWKLWNEDNES--QMCC 459
           K + +DFS +I      G++   W++  E NE   Q CC
Sbjct: 456 KIEVIDFSSYIDVSTDPGHYAIFWEISGETNEDVLQDCC 494


>At1g34610.1 68414.m04301 Ulp1 protease family protein contains Pfam
           profile PF02902: Ulp1 protease family, C-terminal
           catalytic domain
          Length = 997

 Score = 27.5 bits (58), Expect = 7.6
 Identities = 25/92 (27%), Positives = 40/92 (43%), Gaps = 2/92 (2%)
 Frame = -1

Query: 350 LPASVGHDVSVQASHCREH--QKEFQRHSSTQRGGLEFSCGELWCKVERNLRVFPFLEVA 177
           LPA+ G +V V          + E +   S Q+GG + SC ++  +  R L+    +E  
Sbjct: 555 LPAACGINVGVSVPERSNPNTRMEVREEDSIQKGGKKKSCSQMDAQSNRPLKRAKDMEHV 614

Query: 176 QSTVNTGVNSDLVHSTRAGVHFPA*PCGDDVE 81
            ST     N + VH  +  V  P     D+V+
Sbjct: 615 ASTKLE--NKEAVHEPKTYVS-PTEKLDDEVD 643


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 13,199,113
Number of Sequences: 28952
Number of extensions: 273285
Number of successful extensions: 679
Number of sequences better than 10.0: 3
Number of HSP's better than 10.0 without gapping: 667
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 679
length of database: 12,070,560
effective HSP length: 78
effective length of database: 9,812,304
effective search space used: 1255974912
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).