SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fbVf0095
         (760 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At5g59900.1 68418.m07512 pentatricopeptide (PPR) repeat-containi...    28   5.9  
At2g17550.1 68415.m02031 expressed protein                             28   5.9  
At1g67970.1 68414.m07764 heat shock factor protein, putative (HS...    28   7.7  

>At5g59900.1 68418.m07512 pentatricopeptide (PPR) repeat-containing
           protein contains Pfam profile PF01535: PPR repeat
          Length = 907

 Score = 28.3 bits (60), Expect = 5.9
 Identities = 10/18 (55%), Positives = 14/18 (77%)
 Frame = +2

Query: 653 ASFCLLLHARFLSSLSWP 706
           ASFC+L+HA   ++L WP
Sbjct: 105 ASFCILIHALVKANLFWP 122


>At2g17550.1 68415.m02031 expressed protein
          Length = 765

 Score = 28.3 bits (60), Expect = 5.9
 Identities = 18/70 (25%), Positives = 31/70 (44%)
 Frame = +3

Query: 51  RSRDARVKKKTDSIDLRDPNGLRRRVSRFECETRLVKSHCLEPPDSRGSTVSISLPDSAR 230
           R+ D   +  T  + + D N LRR+++  E E ++      EP     + V +  PD   
Sbjct: 527 RNVDYLSQVSTPDVTVSDENELRRQINELESEVQVRTPVEEEPIQEIETIVDLGNPDKVF 586

Query: 231 LASALEAFGI 260
           +   L A G+
Sbjct: 587 VRDLLVASGL 596


>At1g67970.1 68414.m07764 heat shock factor protein, putative (HSF5)
           / heat shock transcription factor, putative (HSTF5)
           identical to heat shock transcription factor 5 (HSF5)
           SP:Q9S7U5 from [Arabidopsis thaliana]; contains Pfam
           profile: PF00447 HSF-type DNA-binding domain
          Length = 374

 Score = 27.9 bits (59), Expect = 7.7
 Identities = 12/44 (27%), Positives = 22/44 (50%)
 Frame = -1

Query: 292 GRWCEATIRGIMPNASKAEASLAESGKDMLTVEPRESGGSKQCD 161
           G W +  +       +K + ++ + GKD LT+E  E  G+ + D
Sbjct: 286 GAWEKLLLLSPSRKKTKKQENIVKKGKDDLTLEEEEEDGTMELD 329


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 17,073,807
Number of Sequences: 28952
Number of extensions: 360171
Number of successful extensions: 935
Number of sequences better than 10.0: 3
Number of HSP's better than 10.0 without gapping: 918
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 935
length of database: 12,070,560
effective HSP length: 79
effective length of database: 9,783,352
effective search space used: 1692519896
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).