SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fbVf0092
         (720 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At5g39900.1 68418.m04839 GTP-binding protein LepA, putative GTP-...    31   1.0  
At4g27570.1 68417.m03960 glycosyltransferase family protein cont...    30   1.3  
At1g50260.1 68414.m05635 C2 domain-containing protein low simila...    30   1.3  
At2g28990.1 68415.m03526 leucine-rich repeat protein kinase, put...    30   1.8  
At5g16980.1 68418.m01989 NADP-dependent oxidoreductase, putative...    28   5.4  
At1g75780.1 68414.m08801 tubulin beta-1 chain (TUB1) nearly iden...    28   5.4  
At5g38450.1 68418.m04648 cytochrome P450 family protein similar ...    28   7.2  
At5g22740.1 68418.m02656 glycosyl transferase family 2 protein s...    28   7.2  
At5g05360.2 68418.m00577 expressed protein similar to unknown pr...    28   7.2  
At5g05360.1 68418.m00578 expressed protein similar to unknown pr...    28   7.2  
At5g02870.1 68418.m00230 60S ribosomal protein L4/L1 (RPL4D) 60S...    28   7.2  
At3g09630.1 68416.m01142 60S ribosomal protein L4/L1 (RPL4A) str...    28   7.2  
At1g01040.1 68414.m00004 DEAD/DEAH box helicase carpel factory /...    27   9.5  

>At5g39900.1 68418.m04839 GTP-binding protein LepA, putative
           GTP-binding protein GUF1 - Saccharomyces cerevisiae,
           PIR:S50374
          Length = 661

 Score = 30.7 bits (66), Expect = 1.0
 Identities = 17/49 (34%), Positives = 27/49 (55%)
 Frame = -1

Query: 684 LGTKHRAPADIIDRAPFPPNRVSNETMKVVVFQRRSRETISHLCYTSHV 538
           LG +H  PA +I+R P PP  +S   +++++F     E    +CY S V
Sbjct: 231 LGLEHVLPA-VIERIPPPPG-ISESPLRMLLFDSFFNEYKGVICYVSVV 277


>At4g27570.1 68417.m03960 glycosyltransferase family protein
           contains Pfam profile: PF00201 UDP-glucoronosyl and
           UDP-glucosyl transferase
          Length = 453

 Score = 30.3 bits (65), Expect = 1.3
 Identities = 20/63 (31%), Positives = 29/63 (46%), Gaps = 1/63 (1%)
 Frame = -1

Query: 675 KHRAPADIIDRAPFPPNRVSNETMKV-VVFQRRSRETISHLCYTSHVSLQCQTRVKLTGS 499
           K   P + ID  P    RV+   M   V+  R +RE   + C   ++   C+ +V LTG 
Sbjct: 175 KKLEPTNTIDVGPNLLERVTTSLMNSDVIAIRTAREIEGNFC--DYIEKHCRKKVLLTGP 232

Query: 498 SFP 490
            FP
Sbjct: 233 VFP 235


>At1g50260.1 68414.m05635 C2 domain-containing protein low
           similarity to CLB1 [Lycopersicon esculentum] GI:2789434;
           contains Pfam profile PF00168: C2 domain
          Length = 675

 Score = 30.3 bits (65), Expect = 1.3
 Identities = 15/39 (38%), Positives = 20/39 (51%)
 Frame = +1

Query: 91  RTRVLRPSADLPSRKVVSVSFRARSARFCTTAVQRSAQN 207
           R+RVLRPS  + + + +S  FR  S     T   R A N
Sbjct: 37  RSRVLRPSVKISNFRFISCGFRGNSKNLRLTDSSRKAAN 75


>At2g28990.1 68415.m03526 leucine-rich repeat protein kinase,
           putative similar to light repressible receptor protein
           kinase [Arabidopsis thaliana] gi|1321686|emb|CAA66376;
           contains leucine rich repeat (LRR) domains,
           Pfam:PF00560; contains protein kinase domain,
           Pfam:PF00069
          Length = 884

 Score = 29.9 bits (64), Expect = 1.8
 Identities = 15/45 (33%), Positives = 21/45 (46%)
 Frame = +2

Query: 74  TFRTGSGPAFSGLPRIFLAVRSCRFRFVRDRHDSVRPPFNGQLRT 208
           T+ T SG       R++L+      R+  D HD +  PFNG   T
Sbjct: 179 TYVTQSGSLMMSF-RVYLSNSDASIRYADDVHDRIWSPFNGSSHT 222


>At5g16980.1 68418.m01989 NADP-dependent oxidoreductase, putative
           strong similarity to probable NADP-dependent
           oxidoreductase (zeta-crystallin homolog) P1
           [SP|Q39172][gi:886428] and P2 [SP|Q39173][gi:886430],
           Arabidopsis thaliana
          Length = 239

 Score = 28.3 bits (60), Expect = 5.4
 Identities = 11/26 (42%), Positives = 17/26 (65%)
 Frame = -2

Query: 98  RVRIQSET*DDFRECHIKYIQFLRPH 21
           R+RIQ     DF + + K+++FL PH
Sbjct: 172 RIRIQGFVVSDFYDEYSKFLEFLHPH 197


>At1g75780.1 68414.m08801 tubulin beta-1 chain (TUB1) nearly
           identical to SP|P12411 Tubulin beta-1 chain {Arabidopsis
           thaliana}
          Length = 447

 Score = 28.3 bits (60), Expect = 5.4
 Identities = 20/93 (21%), Positives = 38/93 (40%), Gaps = 2/93 (2%)
 Frame = +1

Query: 58  SRKSSYVSDWIRTRVLRPSADLPSRKVVSVSFRARSARFCTTAVQRSAQNWHGQGESDCL 237
           ++ SSY  +WI   V     D+P   +   S    ++       +R ++ +         
Sbjct: 336 NKNSSYFVEWIPNNVKSSVCDIPPTGIKMASTFVGNSTSIQEMFRRVSEQFTAMFRRKAF 395

Query: 238 IKTKHWMALAGVDAM*FLPSALNVN--VKKFKQ 330
           +   HW    G+D M F  +  N+N  V +++Q
Sbjct: 396 L---HWYTGEGMDEMEFTEAESNMNDLVSEYQQ 425


>At5g38450.1 68418.m04648 cytochrome P450 family protein similar to
           cytochrome P450 72A1 (SP:Q05047) [Catharanthus roseus]
          Length = 518

 Score = 27.9 bits (59), Expect = 7.2
 Identities = 14/43 (32%), Positives = 21/43 (48%), Gaps = 2/43 (4%)
 Frame = -1

Query: 672 HRAPADIIDRAPFPPNRVSNETM--KVVVFQRRSRETISHLCY 550
           H+  ADII R  F  +    + +   + V QRR  +   HLC+
Sbjct: 204 HKLTADIISRTKFGSSFEKGKELFNHLTVLQRRCAQATRHLCF 246


>At5g22740.1 68418.m02656 glycosyl transferase family 2 protein
           similar to beta-(1-3)-glucosyl transferase GB:AAC62210
           GI:3687658 from [Bradyrhizobium japonicum], cellulose
           synthase from Agrobacterium tumeficiens [gi:710492] and
           Agrobacterium radiobacter [gi:710493]; contains Pfam
           glycosyl transferase, group 2 family protein domain
           PF00535
          Length = 534

 Score = 27.9 bits (59), Expect = 7.2
 Identities = 18/55 (32%), Positives = 27/55 (49%)
 Frame = +2

Query: 26  ASKTVYI*YDTRENRLTFRTGSGPAFSGLPRIFLAVRSCRFRFVRDRHDSVRPPF 190
           ASK + I Y  RENR+ ++ G+     GL R +  V+ C +  + D      P F
Sbjct: 154 ASKGINIRYQIRENRVGYKAGA--LKEGLKRSY--VKHCEYVVIFDADFQPEPDF 204


>At5g05360.2 68418.m00577 expressed protein similar to unknown
           protein (pir||T02500)
          Length = 153

 Score = 27.9 bits (59), Expect = 7.2
 Identities = 22/68 (32%), Positives = 32/68 (47%), Gaps = 3/68 (4%)
 Frame = -1

Query: 639 PFPPNRVSNETMKVVVFQRRSRETISHLCYTSHVSLQCQTRVKLTGSSFPADSPKP---V 469
           P  P+R S      V  ++ +R+T SHL Y++ V L+ +       +  PA    P   V
Sbjct: 20  PTRPHRPSPSPRNKVFVKKTTRDTTSHLDYSNLVKLE-KAGSHSGSNPAPASGSDPINRV 78

Query: 468 PLAVVSLD 445
           PLA V  D
Sbjct: 79  PLAQVVED 86


>At5g05360.1 68418.m00578 expressed protein similar to unknown
           protein (pir||T02500)
          Length = 163

 Score = 27.9 bits (59), Expect = 7.2
 Identities = 22/68 (32%), Positives = 32/68 (47%), Gaps = 3/68 (4%)
 Frame = -1

Query: 639 PFPPNRVSNETMKVVVFQRRSRETISHLCYTSHVSLQCQTRVKLTGSSFPADSPKP---V 469
           P  P+R S      V  ++ +R+T SHL Y++ V L+ +       +  PA    P   V
Sbjct: 20  PTRPHRPSPSPRNKVFVKKTTRDTTSHLDYSNLVKLE-KAGSHSGSNPAPASGSDPINRV 78

Query: 468 PLAVVSLD 445
           PLA V  D
Sbjct: 79  PLAQVVED 86


>At5g02870.1 68418.m00230 60S ribosomal protein L4/L1 (RPL4D) 60S
           roibosomal protein L4, Arabidopsis thaliana,
           EMBL:CAA79104
          Length = 407

 Score = 27.9 bits (59), Expect = 7.2
 Identities = 9/34 (26%), Positives = 20/34 (58%)
 Frame = -1

Query: 357 IVTPAVYPRLLEFLHVDIQSTGQKSHCVNTREGH 256
           ++T  V P ++ F+H  I +  ++ + V+ + GH
Sbjct: 33  VMTAPVRPDIVNFVHAQISNNSRQPYAVSKKAGH 66


>At3g09630.1 68416.m01142 60S ribosomal protein L4/L1 (RPL4A) strong
           similarity to 60S ribosomal protein L1 GB:P49691
          Length = 406

 Score = 27.9 bits (59), Expect = 7.2
 Identities = 9/34 (26%), Positives = 20/34 (58%)
 Frame = -1

Query: 357 IVTPAVYPRLLEFLHVDIQSTGQKSHCVNTREGH 256
           ++T  V P ++ F+H  I +  ++ + V+ + GH
Sbjct: 32  VMTAPVRPDIVNFVHAQISNNSRQPYAVSKKAGH 65


>At1g01040.1 68414.m00004 DEAD/DEAH box helicase carpel factory /
           CAF identical to RNA helicase/RNAseIII CAF protein
           GB:AAF03534 GI:6102610 from [Arabidopsis thaliana]
          Length = 1909

 Score = 27.5 bits (58), Expect = 9.5
 Identities = 13/44 (29%), Positives = 22/44 (50%)
 Frame = +3

Query: 369 GSQMPRHLISDAHEWINEIPTVPIYYLAKPQPRERAWENQRGKK 500
           G  +P + +SD +  INE+   P   +AK   +E   +   GK+
Sbjct: 70  GGGLPNNGVSDTNSQINEVTVTP-QVIAKETVKENGLQKNGGKR 112


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 16,216,356
Number of Sequences: 28952
Number of extensions: 344442
Number of successful extensions: 854
Number of sequences better than 10.0: 13
Number of HSP's better than 10.0 without gapping: 827
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 848
length of database: 12,070,560
effective HSP length: 79
effective length of database: 9,783,352
effective search space used: 1565336320
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).